TkA02G546640 | RubberDandelionOmics

Gene overview

TkA02G546640

Reference: TK1151 Chr: Chr02 Coordinates: 141036906-141038134 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

543 bp · TkA02G546640|TK1151|cDNA

ATGAACATGAAGAACCACCGAAACCCTAATTCTGGGTCCAAAACCAGAGGATCAAAATACACCGGCCAATCCATAAAACCACTCCCGATCCACATCCTTACAGTCGGCAAAACCAGATCGCCAGGAGTCCAATTGATAGTGAAGGACTACATGGAGAAACTCAAACCCTACTGCCCAATTCATGACCTCCGAATCCGATCAAACCCCAAGAACTCAACCGACGCAAGAGTCCAGATTGAAAATGAAGAAATAGGGTTCAT...

CDS

Download CDS FASTA

570 bp · TkA02G546640|TK1151|CDS

ATGGCGATGTGTGTGTTTACCACTCACAACATGAACATGAAGAACCACCGAAACCCTAATTCTGGGTCCAAAACCAGAGGATCAAAATACACCGGCCAATCCATAAAACCACTCCCGATCCACATCCTTACAGTCGGCAAAACCAGATCGCCAGGAGTCCAATTGATAGTGAAGGACTACATGGAGAAACTCAAACCCTACTGCCCAATTCATGACCTCCGAATCCGATCAAACCCCAAGAACTCAACCGACGCAAGAGT...

Protein

Download Protein FASTA

190 aa · TkA02G546640|TK1151|PROTEIN

MAMCVFTTHNMNMKNHRNPNSGSKTRGSKYTGQSIKPLPIHILTVGKTRSPGVQLIVKDYMEKLKPYCPIHDLRIRSNPKNSTDARVQIENEEIGFMNFIKPDDWVVMMDENGMDLRSEDMADLIGDASGCSRLVFCIGGAYGHGMKVRERANVSVKLSSLVLNHEIALVVLIEQLYRAWTILKGQKYHH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G546640`
TK1151 ID	TkA02G546640
OH-1004 ID	LXL04_012665
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G546640

Location Chr02:141036906-141038134 (-)

Description Similar to At5g10620: Putative RNA methyltransferase At5g10620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10620`	Putative RNA methyltransferase At5g10620.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012665 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0070475 rRNA base methylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0070038 rRNA (pseudouridine-N3-)-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G10620

fps:FP1860

gau:GAU_1595

gfo:GFO_1101

mxa:MXAN_1239

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.542

Rank 1 · TkA02G546640 · TK1151

Plastid0.318

Rank 2 · TkA02G546640 · TK1151

Nucleus0.117

Rank 3 · TkA02G546640 · TK1151

Cytoplasm0.061

Rank 4 · TkA02G546640 · TK1151

Peroxisome0.019

Rank 5 · TkA02G546640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02590SPOUT_MTase40-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G546640	`PF02590`	SPOUT_MTase	40	189	3e-41	141.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXB4`	Arabidopsis thaliana	sp\|Q9LXB4\|Y5620_ARATH Putative RNA methyltransferase At5g10620	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card