RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G546320
Reference: TK1151 Chr: Chr02 Coordinates: 140944995-140949142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1889 bp · TkA02G546320|TK1151|cDNA

AAAAAAAAGACCCAATGGTATAGAGAGACTAGGACCCTATGCATCATGACTTATCATCCATCATCACATCAAATGTATGAATGCATGCATGCATAAAGCTTTAAAGAGATAGAAAATGAATGGAGTCGAATGGTATCACCAGATCTACAGACCAAAAGAAGCCATTGGAGACCCCACAATCTCCAGACACAGCTCAAAAGCCAACAAATTAATACCTTTATTCCGGATATGATGTCTGGCGAGATGTTTCCTATTCCTCA...

CDS

Download CDS FASTA

1563 bp · TkA02G546320|TK1151|CDS

ATGGTATCACCAGATCTACAGACCAAAAGAAGCCATTGGAGACCCCACAATCTCCAGACACAGCTCAAAAGCCAACAAATTAATACCTTTATTCCGGATATGATGTCTGGCGAGATGTTTCCTATTCCTCACCACCACCACCACCACCATCAACCACCGCCACCACCACCACCGCAAGTACCAACTCTTGAACCTAACCCTAACCCTAAAGCCATCGCCAATCTCAAGAAGAAGAGAAACTTGCCGGGAACCCCAGATCC...

Protein

Download Protein FASTA

520 aa · TkA02G546320|TK1151|PROTEIN

MVSPDLQTKRSHWRPHNLQTQLKSQQINTFIPDMMSGEMFPIPHHHHHHHQPPPPPPPQVPTLEPNPNPKAIANLKKKRNLPGTPDPDAEVMALSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNTKEPIKKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESVRLTSVTPNSLGLKNEGGMNESV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G546320
TK1151 IDTkA02G546320
OH-1004 IDLXL04_012669
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.400
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G546320
LocationChr02:140944995-140949142 (-)
DescriptionSimilar to JKD: Zinc finger protein JACKDAW
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g03150 Transcription factor that, together with BIB, regulates tissue boundaries and asymmetric cell division by a rapid up-regulation of 'SCARECROW' (SCR), thus controlling the nuclear localization of 'SHORT-ROOT' (SHR) and restricting its action. No verified direct reference in this release
At1g55110 Probable transcription factor. No verified direct reference in this release
At3g45260 Transcription factor that, together with JKD, regulates tissue boundaries and asymmetric cell division in roots by a rapid up-regulation of 'SCARECROW' (SCR), thus controlling the nuclear localization of 'SHORT-ROOT' (SHR) and restricting its action. No verified direct reference in this release
At5g66730 Transcription factor promoting the transition to germination by regulating light and hormonal signaling during seed maturation.
The Arabidopsis C2H2 zinc finger INDETERMINATE DOMAIN1/ENHYDROUS promotes the transition to germination by regulating light and hormonal signaling during seed maturation.2011 · DOI: 10.1105/tpc.111.085134
DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.2014 · DOI: 10.1105/tpc.114.125690
At4g02670 Probable transcription factor. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012669 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0008356 asymmetric cell division Biological Process
GO:0009740 gibberellic acid mediated signaling pathway Biological Process
GO:0009937 regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0010029 regulation of seed germination Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010336 gibberellic acid homeostasis Biological Process
GO:0010431 seed maturation Biological Process
GO:0034504 protein localization to nucleus Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048364 root development Biological Process
KEGG gene cross-reference
ath:AT3G45260
ath:AT3G50700
ath:AT4G02670
ath:AT5G03150
ath:AT5G66730
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978
Rank 1 · TkA02G546320 · TK1151
Cytoplasm0.098
Rank 2 · TkA02G546320 · TK1151
Cell membrane0.017
Rank 3 · TkA02G546320 · TK1151
Mitochondrion0.009
Rank 4 · TkA02G546320 · TK1151
Endoplasmic reticulum0.009
Rank 5 · TkA02G546320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07975C1_499-128 aa
PF23250zf_DPOE_2101-117 aa
PF04810zf-Sec23_Sec24101-112 aa
PF23250zf_DPOE_2103-117 aa
PF02892zf-BED103-117 aa
PF22995C2CH-3rd_BIRD-IDD104-114 aa
PF13912zf-C2H2_6104-127 aa
PF00096zf-C2H2105-127 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G546320PF07975C1_4991283.08.9
TkA02G546320PF23250zf_DPOE_21011170.1612.3
TkA02G546320PF04810zf-Sec23_Sec241011120.311.8
TkA02G546320PF23250zf_DPOE_21031170.1612.3
TkA02G546320PF02892zf-BED1031170.1712.7
TkA02G546320PF22995C2CH-3rd_BIRD-IDD1041148.1e-1554.9
TkA02G546320PF13912zf-C2H2_61041270.02115.5
TkA02G546320PF00096zf-C2H21051277e-0833.2
TkA02G546320PF12171zf-C2H2_jaz1051270.000720.4
TkA02G546320PF12874zf-met1051270.001819.2
TkA02G546320PF13894zf-C2H2_41051270.1513.6
TkA02G546320PF23447DUF71281051147.77.2
TkA02G546320PF07975C1_41361513.08.9
TkA02G546320PF22996C2H2-2nd_BIRD-IDD1431774.2e-2278.6
TkA02G546320PF23447DUF71281511607.77.2
TkA02G546320PF23250zf_DPOE_21651930.1612.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q700D2Arabidopsis thalianasp|Q700D2|IDD10_ARATH Zinc finger protein JACKDAW48.800%Swiss-ProtMedium
Q8H1F5Arabidopsis thalianasp|Q8H1F5|IDD7_ARATH Protein indeterminate-domain 756.500%Swiss-ProtMedium
Q944L3Arabidopsis thalianasp|Q944L3|IDD9_ARATH Zinc finger protein BALDIBIS85.000%Swiss-ProtLow
Q9LVQ7Arabidopsis thalianasp|Q9LVQ7|IDD1_ARATH Zinc finger protein ENHYDROUS85.600%Swiss-ProtLow
O22759Arabidopsis thalianasp|O22759|IDD12_ARATH Protein indeterminate-domain 1284.400%Swiss-ProtLow

JBrowse

View in Genome Browser