TkA02G543810 | RubberDandelionOmics

Gene overview

TkA02G543810

Reference: TK1151 Chr: Chr02 Coordinates: 140255385-140258802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2406 bp · TkA02G543810|TK1151|cDNA

TTTCGCTTTCTCTTCTTCACTCTTTGTTATCTTCTCCTTCTCCGCTCTTCGTATATTCTTTCATCAGTGACGACCAACAGCCACACGGCTTAGTTCGCAGAAAACTAGGGAGGGAATCTATCCACAATATCGTGCCGTACAATCTACTAAAATATGAGCCGAATTCTCGAAATACATCACTGTCGGCCGACGTATTCATTGATGTTCTTCACATGTAAATCGCAGAATTCTAATGCAAATTATCTCACATTCAAGAAGAA...

CDS

Download CDS FASTA

1980 bp · TkA02G543810|TK1151|CDS

ATGAGCCGAATTCTCGAAATACATCACTGTCGGCCGACGTATTCATTGATGTTCTTCACATGTAAATCGCAGAATTCTAATGCAAATTATCTCACATTCAAGAAGAAAAGCGCGGCTAAATCTTCATTACAAGCAAATATTTCAGAGGTGGGGTTGGATCATGTAATTGATAGACGCTCACTCGAACACAAGTTTCAGGTCCAAGAAGACGATGTAAACGCATTCAATTCACTTCCACACGTGAGACGTCTTAGCGAGCT...

Protein

Download Protein FASTA

659 aa · TkA02G543810|TK1151|PROTEIN

MSRILEIHHCRPTYSLMFFTCKSQNSNANYLTFKKKSAAKSSLQANISEVGLDHVIDRRSLEHKFQVQEDDVNAFNSLPHVRRLSELQKHELYRKLVMVRFDSNILLGENQNPEAKIFTTALSTIKYLHESGANVILISSWSSKTNSLDSVSSYLSSILKLKVLPMKLYQGYKPNKEPSIYLLENLSQFKDEVANNSTFCKKLCTGVDIFINDSFFQSHKTLASTIGVTSFCYSSIAGFQFELGLLQLKKAFDTKKSPYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G543810`
TK1151 ID	TkA02G543810
OH-1004 ID	LXL04_012709
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G543810`
Location	Chr02:140255385-140258802 (+)
Description	Similar to Phosphoglycerate kinase, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012709` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006094 gluconeogenesis Biological Process GO:0006096 glycolytic process Biological Process GO:0010027 thylakoid membrane organization Biological Process GO:0019253 reductive pentose-phosphate cycle Biological Process GO:0019375 galactolipid biosynthetic process Biological Process GO:0050691 regulation of defense response to virus by host Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component
KEGG gene cross-reference	ath:AT1G56190 syf:Synpcc7942_1116 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.779

Rank 1 · TkA02G543810 · TK1151

Mitochondrion0.109

Rank 2 · TkA02G543810 · TK1151

Nucleus0.105

Rank 3 · TkA02G543810 · TK1151

Cytoplasm0.097

Rank 4 · TkA02G543810 · TK1151

Peroxisome0.029

Rank 5 · TkA02G543810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13419HAD_265-193 aa

PF00162PGK89-423 aa

PF13679Methyltransf_32477-532 aa

PF02390Methyltransf_4479-651 aa

PF24675NpmA482-513 aa

PF05175MTS483-595 aa

PF13847Methyltransf_31484-539 aa

PF13649Methyltransf_25484-539 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G543810	`PF13419`	HAD_2	65	193	0.1	13.3
TkA02G543810	`PF00162`	PGK	89	423	1.8e-51	176.1
TkA02G543810	`PF13679`	Methyltransf_32	477	532	0.019	15.7
TkA02G543810	`PF02390`	Methyltransf_4	479	651	1.6e-24	87.0
TkA02G543810	`PF24675`	NpmA	482	513	0.096	12.7
TkA02G543810	`PF05175`	MTS	483	595	0.19	12.0
TkA02G543810	`PF13847`	Methyltransf_31	484	539	0.00015	22.3
TkA02G543810	`PF13649`	Methyltransf_25	484	539	0.16	13.4
TkA02G543810	`PF29244`	Methyltransf_ANTKMT	485	530	0.014	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card