LXL04_012709 | RubberDandelionOmics

Gene overview

LXL04_012709

Reference: OH-1004 Chr: Chr03 Coordinates: 17405910-17408901 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2055 bp · LXL04_012709|LXL04_012709|OH1004|cDNA

ATGAGCCGAATTCTCGAAATACATCACTGTCGGCCGACGTATTCATTGATGTTCTTCACATGTAAATCGCAGAATTCTAATGCAAATTATCTCACATTCAAGAAGAAAAGCGCGGCTAAATCTTCATTACAAGCAAATATTTCAGAGGTGGGGTTGGATCATGTAATTGATAGACGCTCACTCGAACACAAGGTCCAAGAAGACGATGTAAACGCATTCAATTCACTTCCACACGTGAGACGTCTTAGCGAGCTTCAAAA...

CDS

Download CDS FASTA

2055 bp · LXL04_012709|LXL04_012709|OH1004|CDS

ATGAGCCGAATTCTCGAAATACATCACTGTCGGCCGACGTATTCATTGATGTTCTTCACATGTAAATCGCAGAATTCTAATGCAAATTATCTCACATTCAAGAAGAAAAGCGCGGCTAAATCTTCATTACAAGCAAATATTTCAGAGGTGGGGTTGGATCATGTAATTGATAGACGCTCACTCGAACACAAGGTCCAAGAAGACGATGTAAACGCATTCAATTCACTTCCACACGTGAGACGTCTTAGCGAGCTTCAAAA...

Protein

Download Protein FASTA

684 aa · LXL04_012709|LXL04_012709|OH1004|PROTEIN

MSRILEIHHCRPTYSLMFFTCKSQNSNANYLTFKKKSAAKSSLQANISEVGLDHVIDRRSLEHKVQEDDVNAFNSLPHVRRLSELQKHELYRKLVMVRFDSNILLGENQNPEAKIFTTALSTIKYLHESGANVILISSWSSKTNSLDSVSSYLSSILKLKVLPMKLYQGYKPNKEPSIYLLENLSQFKDEVANNSTFCKKLCTGVDIFINDSFFQSHKTLASTIGVTSFCYSSIAGFQFELGLLQLKKAFDTKKSPYIAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012709`
TK1151 ID	TkA02G543810
OH-1004 ID	LXL04_012709
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012709

Location Chr03:17405910-17408901 (-)

Description Similar to Phosphoglycerate kinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56190`	Phosphoglycerate kinase 2, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012709 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0050691 regulation of defense response to virus by host Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G56190

syf:Synpcc7942_1116

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.773

Rank 1 · LXL04_012709 · OH-1004

Nucleus0.118

Rank 2 · LXL04_012709 · OH-1004

Mitochondrion0.094

Rank 3 · LXL04_012709 · OH-1004

Cytoplasm0.093

Rank 4 · LXL04_012709 · OH-1004

Peroxisome0.026

Rank 5 · LXL04_012709 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00162.25PGK87-447 aa

PF02390.24Methyltransf_4503-676 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012709	`PF00162.25`	PGK	87	447	5.8e-47	161.2
LXL04_012709	`PF02390.24`	Methyltransf_4	503	676	5.7e-23	82.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P50318`	Arabidopsis thaliana	Phosphoglycerate kinase 2, chloroplastic	26.850%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card