RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G541220
Reference: TK1151 Chr: Chr02 Coordinates: 139645721-139650454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3812 bp · TkA02G541220|TK1151|cDNA

TAAAAGTGGAAAACGTGCCACCACATCAATTATCATATAAAACGAATGCTATTCACCTATCCCCCACCTTCTCTCCCCTGTATTCTCGATTTTGTCCGAACAGAGAACCTTTCCAAAACGATAACAGACTCCCCCGATCTCTGTCCCACCCTAGATTTTCTCCTTTTTTCAACTTATCTCTGCACATTTGCTGATTGATTTTAGCTATGGCTGCCAGGGATCATGCCCCTGATGACCTTTTCTCGTCGTTGAACTCATCT...

CDS

Download CDS FASTA

3381 bp · TkA02G541220|TK1151|CDS

ATGGCTGCCAGGGATCATGCCCCTGATGACCTTTTCTCGTCGTTGAACTCATCTCCGGCAAGTCCTCAGATTAACTTTGGTAGCAATTCGCCCAATTTGATTAGTTTTGATGACGACGGTGAAGAGGATTATGATAACGGAAGTACGAGTAGTAAACCCCTTATGGTTTTTGATCGGTTCTACGACTCTTCATCGGAAGATGGGTTATACTCAACTGGAAGTGCCGGTGGTGATGGTGATAATTCTCTAGCGCAGGCCGC...

Protein

Download Protein FASTA

1126 aa · TkA02G541220|TK1151|PROTEIN

MAARDHAPDDLFSSLNSSPASPQINFGSNSPNLISFDDDGEEDYDNGSTSSKPLMVFDRFYDSSSEDGLYSTGSAGGDGDNSLAQAAGNRLDYMMQYLDRKLLLVEGKDNELDQALPEFIGSGGGRGVFKLPIRAAVHPARPPSLEFRPHPLRETQIGRFLRILKGTADGRQLWAGSECGVRFWDMKDMYAARMEEGNDEAEVPFYESVNTPPTLCLVVDDANKVVWSGHKDGKIRCWKMFQSTDEIKVPFRECLSWQAH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G541220
TK1151 IDTkA02G541220
OH-1004 IDLXL04_012729
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)96.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G541220
LocationChr02:139645721-139650454 (+)
DescriptionSimilar to IP5P15: Type II inositol polyphosphate 5-phosphatase 15
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g65580 May have phosphatase activity toward PtdIns(4,5)P₂, PtdIns(3,4,5)P₃ and Ins(1,4,5)P₃.
FRAGILE FIBER3, an Arabidopsis gene encoding a type II inositol polyphosphate 5-phosphatase, is required for secondary wall synthesis and actin organization in fiber cells.2004 · DOI: 10.1105/tpc.104.027466
At1g05630 Converts inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) to inositol 1,4-bisphosphate.
Molecular and biochemical characterization of three WD-repeat-domain-containing inositol polyphosphate 5-phosphatases in Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch187
At5PTase13 modulates cotyledon vein development through regulating auxin homeostasis.2005 · DOI: 10.1104/pp.105.067140
An inositol polyphosphate 5-phosphatase functions in PHOTOTROPIN1 signaling in Arabidopis by altering cytosolic Ca2+.2008 · DOI: 10.1105/tpc.107.052670
The role of Arabidopsis 5PTase13 in root gravitropism through modulation of vesicle trafficking.2009 · DOI: 10.1038/cr.2009.105
At2g43900 May have phosphatase activity toward Ins(1,4,5)P₃.
Molecular and biochemical characterization of three WD-repeat-domain-containing inositol polyphosphate 5-phosphatases in Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch187
At2g31830 May have phosphatase activity toward PtdIns(4,5)P₂, PtdIns(3,4,5)P₃ and Ins(1,4,5)P₃.
Molecular and biochemical characterization of three WD-repeat-domain-containing inositol polyphosphate 5-phosphatases in Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch187

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012729 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0007584 response to nutrient Biological Process
GO:0009611 response to wounding Biological Process
GO:0009630 gravitropism Biological Process
GO:0009637 response to blue light Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009743 response to carbohydrate Biological Process
GO:0009846 pollen germination Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010182 sugar mediated signaling pathway Biological Process
GO:0043647 inositol phosphate metabolic process Biological Process
GO:0046856 phosphatidylinositol dephosphorylation Biological Process
KEGG gene cross-reference
ath:AT1G05630
ath:AT1G65580
ath:AT2G31830
ath:AT2G43900
hsa:3633
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.414
Rank 1 · TkA02G541220 · TK1151
Nucleus0.315
Rank 2 · TkA02G541220 · TK1151
Cell membrane0.177
Rank 3 · TkA02G541220 · TK1151
Golgi apparatus0.127
Rank 4 · TkA02G541220 · TK1151
Lysosome / Vacuole0.096
Rank 5 · TkA02G541220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos34-94 aa
PF12423KIF1B48-66 aa
PF23754Beta-prop_IP5PC_F152-540 aa
PF07494Reg_prop167-177 aa
PF00400WD40175-185 aa
PF25173Beta-prop_WDR3_1st181-298 aa
PF12423KIF1B183-208 aa
PF23409Beta-prop_EML200-304 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G541220PF03372Exo_endo_phos34942.1e-0628.4
TkA02G541220PF12423KIF1B48668.67.4
TkA02G541220PF23754Beta-prop_IP5PC_F1525407.8e-159529.5
TkA02G541220PF07494Reg_prop1671770.01616.0
TkA02G541220PF00400WD401751850.9410.9
TkA02G541220PF25173Beta-prop_WDR3_1st1812986.6e-0729.9
TkA02G541220PF12423KIF1B1832088.67.4
TkA02G541220PF23409Beta-prop_EML2003043.2e-0730.8
TkA02G541220PF24817WD40_WDHD1_1st2122930.1312.2
TkA02G541220PF23869Beta-prop_WDR75_1st2162983.8e-0523.9
TkA02G541220PF07494Reg_prop2162290.01616.0
TkA02G541220PF29037DSE1_N2202900.005316.6
TkA02G541220PF00400WD402222380.9410.9
TkA02G541220PF25047Beta-prop_TEP1_2nd2232965.6e-0729.7
TkA02G541220PF00400WD402562870.9410.9
TkA02G541220PF23381Beta-prop_IFT122_1st2572960.007816.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84W55Arabidopsis thalianasp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 1557.000%Swiss-ProtHigh
Q9SYK4Arabidopsis thalianasp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 1357.300%Swiss-ProtHigh
O80560Arabidopsis thalianasp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 1256.600%Swiss-ProtHigh
Q9SKB7Arabidopsis thalianasp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 1453.600%Swiss-ProtHigh

JBrowse

View in Genome Browser