LXL04_012729 | RubberDandelionOmics

Gene overview

LXL04_012729

Reference: OH-1004 Chr: Chr03 Coordinates: 17909369-17913672 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3486 bp · LXL04_012729|LXL04_012729|OH1004|cDNA

ATGGCTGCCAGGGATCATGCCCCTGATGACCTTTTCTCGTCGTTGAACTCATCTCCGGCAAGTCCTCAGATTAACTTTGGTAGCAATTCGCCCAATTTGATTAGTTTTGATGACGACGGTGAAGAGGATTATGATAACGGAAGTACGAGTAGTAAACCCCTTATGGTTTTTGATCGGTTCTACGACTCTTCATCGGAAGATGGGTTATACTCAACTGGAAGTGCCGGTGGTGATGGTGATAATTCTCTAGCGCAGGCCGC...

CDS

Download CDS FASTA

3486 bp · LXL04_012729|LXL04_012729|OH1004|CDS

ATGGCTGCCAGGGATCATGCCCCTGATGACCTTTTCTCGTCGTTGAACTCATCTCCGGCAAGTCCTCAGATTAACTTTGGTAGCAATTCGCCCAATTTGATTAGTTTTGATGACGACGGTGAAGAGGATTATGATAACGGAAGTACGAGTAGTAAACCCCTTATGGTTTTTGATCGGTTCTACGACTCTTCATCGGAAGATGGGTTATACTCAACTGGAAGTGCCGGTGGTGATGGTGATAATTCTCTAGCGCAGGCCGC...

Protein

Download Protein FASTA

1161 aa · LXL04_012729|LXL04_012729|OH1004|PROTEIN

MAARDHAPDDLFSSLNSSPASPQINFGSNSPNLISFDDDGEEDYDNGSTSSKPLMVFDRFYDSSSEDGLYSTGSAGGDGDNSLAQAAGNRLDYMMQYLDRKLLLVEGKDNELDQALPEFIGSGGGRGVFKLPIRAAVHPARPPSLEFRPHPLRETQIGRFLRILKGTADGRQLWAGSECGVRFWDMKDMYAARMEEGNDEAEVPFYESVNTPPTLCLVVDDANKVVWSGHKDGKIRCWKMFQSTDEIKVPFRECLSWQAH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012729`
TK1151 ID	TkA02G541220
OH-1004 ID	LXL04_012729
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012729

Location Chr03:17909369-17913672 (-)

Description Similar to IP5P15: Type II inositol polyphosphate 5-phosphatase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65580`	May have phosphatase activity toward PtdIns(4,5)P₂, PtdIns(3,4,5)P₃ and Ins(1,4,5)P₃.	FRAGILE FIBER3, an Arabidopsis gene encoding a type II inositol polyphosphate 5-phosphatase, is required for secondary wall synthesis and actin organization in fiber cells.2004 · DOI: 10.1105/tpc.104.027466
`At1g05630`	Converts inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) to inositol 1,4-bisphosphate.	Molecular and biochemical characterization of three WD-repeat-domain-containing inositol polyphosphate 5-phosphatases in Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch187 At5PTase13 modulates cotyledon vein development through regulating auxin homeostasis.2005 · DOI: 10.1104/pp.105.067140 An inositol polyphosphate 5-phosphatase functions in PHOTOTROPIN1 signaling in Arabidopis by altering cytosolic Ca2+.2008 · DOI: 10.1105/tpc.107.052670 The role of Arabidopsis 5PTase13 in root gravitropism through modulation of vesicle trafficking.2009 · DOI: 10.1038/cr.2009.105
`At2g43900`	May have phosphatase activity toward Ins(1,4,5)P₃.	Molecular and biochemical characterization of three WD-repeat-domain-containing inositol polyphosphate 5-phosphatases in Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch187
`At2g31830`	May have phosphatase activity toward PtdIns(4,5)P₂, PtdIns(3,4,5)P₃ and Ins(1,4,5)P₃.	Molecular and biochemical characterization of three WD-repeat-domain-containing inositol polyphosphate 5-phosphatases in Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch187

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012729 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009611 response to wounding Biological Process

GO:0009630 gravitropism Biological Process

GO:0009637 response to blue light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009743 response to carbohydrate Biological Process

GO:0009846 pollen germination Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0043647 inositol phosphate metabolic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G05630

ath:AT1G65580

ath:AT2G31830

ath:AT2G43900

hsa:3633

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · LXL04_012729 · OH-1004

Nucleus0.292

Rank 2 · LXL04_012729 · OH-1004

Cell membrane0.183

Rank 3 · LXL04_012729 · OH-1004

Golgi apparatus0.148

Rank 4 · LXL04_012729 · OH-1004

Endoplasmic reticulum0.103

Rank 5 · LXL04_012729 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23754.2Beta-prop_IP5PC_F152-540 aa

PF25173.2Beta-prop_WDR3_1st181-298 aa

PF22669.3Exo_endo_phos2575-937 aa

PF03372.30Exo_endo_phos575-933 aa

PF23755.2Ig-like_IP5PC_F976-1112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012729	`PF23754.2`	Beta-prop_IP5PC_F	152	540	8.1e-159	529.4
LXL04_012729	`PF25173.2`	Beta-prop_WDR3_1st	181	298	7e-07	29.8
LXL04_012729	`PF22669.3`	Exo_endo_phos2	575	937	1.5e-66	225.6
LXL04_012729	`PF03372.30`	Exo_endo_phos	575	933	7.1e-06	26.7
LXL04_012729	`PF23755.2`	Ig-like_IP5PC_F	976	1112	3.7e-63	212.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W55`	Arabidopsis thaliana	Type II inositol polyphosphate 5-phosphatase 15	58.440%	Swiss-Prot	strong database homology
`Q9SYK4`	Arabidopsis thaliana	Type I inositol polyphosphate 5-phosphatase 13	53.987%	Swiss-Prot	strong database homology
`O80560`	Arabidopsis thaliana	Type I inositol polyphosphate 5-phosphatase 12	55.166%	Swiss-Prot	strong database homology
`Q9SKB7`	Arabidopsis thaliana	Type II inositol polyphosphate 5-phosphatase 14	51.876%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card