TkA02G538900 | RubberDandelionOmics

Gene overview

TkA02G538900

Reference: TK1151 Chr: Chr02 Coordinates: 138985130-138986322 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1032 bp · TkA02G538900|TK1151|cDNA

CCCTTTAAACTCAAGCCTCAAAATATTGGCACACACACAATAACCACAAACACGTATAAAGCACAATAGTAGTATCAAACTGAGATTCAAATTTAGGAAGCCAAAAAATGACGATTTCATTGTTCCAAACGCTCTTATATCCACCACCATCTTCCTTGTTCGTCAATGTAATGTCGATATTAAGTTGTTTGTCGCTCTCAAATGGTGGTTACATGGAAACAAAAGGCAAACACATGCAGTATTCCAAGTTCTTCAATGTC...

CDS

Download CDS FASTA

810 bp · TkA02G538900|TK1151|CDS

ATGACGATTTCATTGTTCCAAACGCTCTTATATCCACCACCATCTTCCTTGTTCGTCAATGTAATGTCGATATTAAGTTGTTTGTCGCTCTCAAATGGTGGTTACATGGAAACAAAAGGCAAACACATGCAGTATTCCAAGTTCTTCAATGTCGTAGCTTCAAAGAAAGCCAAGGTTCAGGAGACCATGGTGGGTAGTAGAATCGGGATGCTTTTATTCTATACACCAGCGTTCTTTGTGGGTCTTGGCTCTTTCGCCAT...

Protein

Download Protein FASTA

269 aa · TkA02G538900|TK1151|PROTEIN

MTISLFQTLLYPPPSSLFVNVMSILSCLSLSNGGYMETKGKHMQYSKFFNVVASKKAKVQETMVGSRIGMLLFYTPAFFVGLGSFAIFSDRDLRFTILISVLTIHFLKRVLEVLFVHKYSGSMALEATITISLSYTISTLTMIYAQYLSHEHSKPTIDLKNVGTVLFFVGIVGNFYHHHILSNLRTKDDRGYKIPKGGLFGLVICPHYLFEIIEFIGVSCIAQTTYVFAFSLGTMFYLMGRSYATRQWYISEFGDKFGDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G538900`
TK1151 ID	TkA02G538900
OH-1004 ID	LXL04_012783
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.885 / OH-1004 30.575 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G538900`
Location	Chr02:138985130-138986322 (+)
Description	Similar to At1g12700: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012783` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006396 RNA processing Biological Process GO:0080156 mitochondrial mRNA modification Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference	ath:AT1G12700 ath:AT1G12775 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.872

Rank 1 · TkA02G538900 · TK1151

Nucleus0.076

Rank 2 · TkA02G538900 · TK1151

Cytoplasm0.059

Rank 3 · TkA02G538900 · TK1151

Golgi apparatus0.044

Rank 4 · TkA02G538900 · TK1151

Mitochondrion0.039

Rank 5 · TkA02G538900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27331YnaG49-83 aa

PF16972TipE70-89 aa

PF27331YnaG97-171 aa

PF06966DUF1295130-226 aa

PF02544Steroid_dh140-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G538900	`PF27331`	YnaG	49	83	0.18	12.7
TkA02G538900	`PF16972`	TipE	70	89	0.28	11.1
TkA02G538900	`PF27331`	YnaG	97	171	0.18	12.7
TkA02G538900	`PF06966`	DUF1295	130	226	0.014	15.6
TkA02G538900	`PF02544`	Steroid_dh	140	269	5e-26	92.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card