TkA02G538020 | RubberDandelionOmics

Gene overview

TkA02G538020

Reference: TK1151 Chr: Chr02 Coordinates: 138761992-138765623 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1878 bp · TkA02G538020|TK1151|cDNA

TGGAAAGAGACGTTCTCAGGCGTTATGGTCTTAACGGAAGGGTTCTAAGTTCTAACTTCTACCCTTGCTCATTTGTTTGGGTTTATCTTTCAAAGCTCAAAAAAAAAAAGAAAAAAAAAGGAAAATGACAAATTACAAAAATACCCCTCGGTACCTCTACAAACCTATTCTTACCCTTAAACCCTTGTTCGCTTTCTCCCAGACGACACCAAAATCTCTATCTCCGTCTCAACATCGGCCTTCTCCTGGACTGTAAATCT...

CDS

Download CDS FASTA

1344 bp · TkA02G538020|TK1151|CDS

ATGGCGAAAAAACGAGAAAGACAACAAAATCCAGAACCTTTCTTATCAGATGACACCAACAAATCCGTCTCCAAAAAGCGCACCAAACCCGCTAAACAGCATCAGGGCGAAGAAAAGCTTATATCAGCGGGCATGAGCTCCAAAATTCTAAAAGAGGCTTTACTTCAACAAAAGGAGATACAGGAAGAGACAGATGCTGAAAACCCTAATAACATTGTTTTCCCCGAAGAACCTGTGACTCAGACTCAAGTAGATGATGA...

Protein

Download Protein FASTA

447 aa · TkA02G538020|TK1151|PROTEIN

MAKKRERQQNPEPFLSDDTNKSVSKKRTKPAKQHQGEEKLISAGMSSKILKEALLQQKEIQEETDAENPNNIVFPEEPVTQTQVDDDDDDVDNFAGFSDNHSHFGGYEEEINEDDEKLLEAFFSKDTRPQQTLADVILQKIKQKDNMPPGLSAVLPQIPKLDDSIIEIYKSVGEIFKKYTSGKLPLAFKSIPAKQNWEELLFLTEPEKWSPNAVYQATRILASNMSSSKVTRFYNLFLLPRIRQDIRKNKKLHFALYQAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G538020`
TK1151 ID	TkA02G538020
OH-1004 ID	LXL04_037886
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 99.776 / OH-1004 96.537 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G538020

Location Chr02:138761992-138765623 (-)

Description Similar to ENP1: Bystin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31660`	Essential protein required during embryogenesis and pollen development.	40S ribosome biogenesis co-factors are essential for gametophyte and embryo development.2013 · DOI: 10.1371/journal.pone.0054084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037886 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006364 rRNA processing Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:1904749 regulation of protein localization to nucleolus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G31660

bta:514128

hsa:705

mbr:MONBRDRAFT_17006

mmu:53414

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.890

Rank 1 · TkA02G538020 · TK1151

Cytoplasm0.204

Rank 2 · TkA02G538020 · TK1151

Mitochondrion0.028

Rank 3 · TkA02G538020 · TK1151

Cell membrane0.027

Rank 4 · TkA02G538020 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA02G538020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05291Bystin129-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G538020	`PF05291`	Bystin	129	414	8e-123	410.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWS4`	Arabidopsis thaliana	sp\|Q8RWS4\|BYST_ARATH Bystin	57.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card