TkA02G537470 | RubberDandelionOmics

Gene overview

TkA02G537470

Reference: TK1151 Chr: Chr02 Coordinates: 138619704-138622148 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1610 bp · TkA02G537470|TK1151|cDNA

TAGACCGTCAATATCTACCTCTTCAAATACTATCACCCTCCTAGACTCCTACCCTCAAATTCCAAGCACTCCTCTCGACCAACACAACCAAGCCAAGTCTTCCCTCCTCCCTTAGGATCTACTTCTTCGTAGTTTTGTAATTGAGTATTGAAGATCGAAGAACAGGATGTTTGGAAGAGCACCCAAGAAGAGCGATAATACGAAGTACTATGAGATCCTTGGGGTCCCGAAGAATGCTTCCCAGGATGATCTCAAGAAGG...

CDS

Download CDS FASTA

1263 bp · TkA02G537470|TK1151|CDS

ATGTTTGGAAGAGCACCCAAGAAGAGCGATAATACGAAGTACTATGAGATCCTTGGGGTCCCGAAGAATGCTTCCCAGGATGATCTCAAGAAGGCTTATCGTAAAGCCGCCATTAAAAATCACCCTGATAAGGGAGGAGATCCTGAGAAGTTTAAAGAGCTTGCCCAAGCCTATGAGGTATTGAGTGACCCAGAGAAGCGTGAGATATATGACCAGTATGGTGAGGATGCCTTGAAAGAAGGAATGGGAGGTGGAGGTGG...

Protein

Download Protein FASTA

420 aa · TkA02G537470|TK1151|PROTEIN

MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGNPFGGAGGSRGGRRQRRGEDVIHPLKVSLEDLYNGISKKLSLSRNVLCSKCKGKGSKSGASMKCAGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVVQEKKVLEVHVEKGMQNSQKITFPGEADEAPDTVTGDIVFVLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G537470`
TK1151 ID	TkA02G537470
OH-1004 ID	LXL04_012801
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G537470

Location Chr02:138619704-138622148 (+)

Description Similar to DNAJ1: DnaJ protein homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22060`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0001671 ATPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT5G22060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.693

Rank 1 · TkA02G537470 · TK1151

Nucleus0.407

Rank 2 · TkA02G537470 · TK1151

Cell membrane0.140

Rank 3 · TkA02G537470 · TK1151

Endoplasmic reticulum0.103

Rank 4 · TkA02G537470 · TK1151

Mitochondrion0.074

Rank 5 · TkA02G537470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ13-71 aa

PF30912TIM141_C16-53 aa

PF01556DnaJ_C125-345 aa

PF30912TIM141_C139-158 aa

PF18551TackOD1145-172 aa

PF27659CHP02642146-174 aa

PF01155HypA147-176 aa

PF25436BSD2_CRD147-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G537470	`PF00226`	DnaJ	13	71	4.2e-24	85.1
TkA02G537470	`PF30912`	TIM141_C	16	53	2.5e-05	24.9
TkA02G537470	`PF01556`	DnaJ_C	125	345	6.8e-36	124.3
TkA02G537470	`PF30912`	TIM141_C	139	158	2.5e-05	24.9
TkA02G537470	`PF18551`	TackOD1	145	172	0.23	11.7
TkA02G537470	`PF27659`	CHP02642	146	174	1.5	9.0
TkA02G537470	`PF01155`	HypA	147	176	0.066	14.0
TkA02G537470	`PF25436`	BSD2_CRD	147	175	0.24	12.3
TkA02G537470	`PF22289`	DmmA-like_C	148	170	5.7	7.7
TkA02G537470	`PF15777`	Anti-TRAP	149	174	0.0013	19.4
TkA02G537470	`PF07191`	Zn_ribbon_6	149	196	5.4	7.8
TkA02G537470	`PF28686`	HUA1_small	149	169	8.5	7.0
TkA02G537470	`PF00684`	DnaJ_CXXCXGXG	150	216	1.6e-15	57.9
TkA02G537470	`PF15777`	Anti-TRAP	187	218	0.0013	19.4
TkA02G537470	`PF01155`	HypA	187	217	0.066	14.0
TkA02G537470	`PF18551`	TackOD1	189	223	0.23	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42825`	Arabidopsis thaliana	sp\|P42825\|DNAJ2_ARATH Chaperone protein dnaJ 2	77.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card