Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4625 bp · TkA02G536060|TK1151|cDNA
TCATATATGCCCTTTATATCTCTACCTAATTCCAAAGTTTATTGTGTACACATTTTCATACAACTCATACAGTTTCCTTTATAGATATTTGATATACAGGATCCTCTTCAATCATACCATCTATGGCGTCTTCTTCAACTTCATCCATTCACAAGGCCTTCACATATGATGTATTTTTGAGTTTTGGAGGCAAAGACACCCGTACCAACTTCATTGATCATCTTTATCATGCTTTTCTGGACAGAAACATTCGCACTTAC...
3261 bp · TkA02G536060|TK1151|CDS
ATGGCGTCTTCTTCAACTTCATCCATTCACAAGGCCTTCACATATGATGTATTTTTGAGTTTTGGAGGCAAAGACACCCGTACCAACTTCATTGATCATCTTTATCATGCTTTTCTGGACAGAAACATTCGCACTTACAAGGATGACGAGGAAATCAACAAAGGGAAAGAAATCACTGACGAGCTCATGAAAGCCATTGAAAGCTCAAAATACTTCATTATTGTATTCTCCAAAAACTATGCCTCTTCATCTTGGTGCTT...
Protein
Download Protein FASTA1086 aa · TkA02G536060|TK1151|PROTEIN
MASSSTSSIHKAFTYDVFLSFGGKDTRTNFIDHLYHAFLDRNIRTYKDDEEINKGKEITDELMKAIESSKYFIIVFSKNYASSSWCLEELVKIMDCHKTTKHNAYPVFYDVEPWEVRYQSGAVGETFAGHKKEESAGKWTVALKEAADLAGWELKNTAGGHEAKCIRQIVEKLLLELRSINVHVDKNLVGMETRVNDIISSLETDSDEVHMIGIKGIGGGGKTTLARAVYDKIFFQFEGKSFIDKVREVSNDSSSGLKLL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G536060 |
|---|---|
| TK1151 ID | TkA02G536060 |
| OH-1004 ID | LXL04_012832 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 63.720 / OH-1004 39.954Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G536060 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:138241559-138252599 (-) | |||||||||
| Description | Similar to At2g25100: Ribonuclease H2 subunit A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006298 mismatch repair Biological Process GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0043137 DNA replication, removal of RNA primer Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0032299 ribonuclease H2 complex Cellular Component GO:0003723 RNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G25100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01582TIR15-178 aaPF13676TIR_217-112 aaPF00931NB-ARC27-74 aaPF08937ThsB_TIR35-93 aaPF23282WHD_ROQ1179-191 aaPF00931NB-ARC192-365 aaPF25199nSTAND_NTPase5195-228 aaPF13238AAA_18212-342 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G536060 | PF01582 | TIR | 15 | 178 | 2.4e-43 | 148.7 |
| TkA02G536060 | PF13676 | TIR_2 | 17 | 112 | 3.5e-15 | 57.3 |
| TkA02G536060 | PF00931 | NB-ARC | 27 | 74 | 3.5e-21 | 76.3 |
| TkA02G536060 | PF08937 | ThsB_TIR | 35 | 93 | 0.3 | 12.2 |
| TkA02G536060 | PF23282 | WHD_ROQ1 | 179 | 191 | 9.6e-14 | 52.0 |
| TkA02G536060 | PF00931 | NB-ARC | 192 | 365 | 3.5e-21 | 76.3 |
| TkA02G536060 | PF25199 | nSTAND_NTPase5 | 195 | 228 | 0.13 | 12.8 |
| TkA02G536060 | PF13238 | AAA_18 | 212 | 342 | 0.2 | 12.8 |
| TkA02G536060 | PF13401 | AAA_22 | 214 | 320 | 0.015 | 16.3 |
| TkA02G536060 | PF25199 | nSTAND_NTPase5 | 292 | 330 | 0.13 | 12.8 |
| TkA02G536060 | PF23282 | WHD_ROQ1 | 435 | 501 | 9.6e-14 | 52.0 |
| TkA02G536060 | PF23622 | LRR_At1g61320_AtMIF1 | 443 | 472 | 2.2e-09 | 37.9 |
| TkA02G536060 | PF08937 | ThsB_TIR | 508 | 524 | 0.3 | 12.2 |
| TkA02G536060 | PF12799 | LRR_4 | 551 | 562 | 7.1e-07 | 30.0 |
| TkA02G536060 | PF24758 | LRR_At5g56370 | 618 | 777 | 2.6e-07 | 31.3 |
| TkA02G536060 | PF07725 | LRR_3 | 623 | 640 | 0.015 | 15.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.