LXL04_012832 | RubberDandelionOmics

Gene overview

LXL04_012832

Reference: OH-1004 Chr: Chr03 Coordinates: 19506202-19517571 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5199 bp · LXL04_012832|LXL04_012832|OH1004|cDNA

ATGGTGGCAGATGCAGTGGTTGATAAGGAGGCTGAGGAGCTACAATATAGTGACTCGAGGACGAGCTATTCGGCTTGTGTTGAAGCCGTTGACATGGGATCGGAAGCTGAAATTCCGGAATGGGCATCAACGCCTTGTATAATGGGCATCGACGAAGCTGGTCGCGGCCCTGTTTTAGGACCGATGGTTTATGGATGCCTGTATTGTCCGGTTTCATACAAGAAAACCCTTTCCACTTTGGAATTTGCAGATTCAAAGAC...

CDS

Download CDS FASTA

5199 bp · LXL04_012832|LXL04_012832|OH1004|CDS

ATGGTGGCAGATGCAGTGGTTGATAAGGAGGCTGAGGAGCTACAATATAGTGACTCGAGGACGAGCTATTCGGCTTGTGTTGAAGCCGTTGACATGGGATCGGAAGCTGAAATTCCGGAATGGGCATCAACGCCTTGTATAATGGGCATCGACGAAGCTGGTCGCGGCCCTGTTTTAGGACCGATGGTTTATGGATGCCTGTATTGTCCGGTTTCATACAAGAAAACCCTTTCCACTTTGGAATTTGCAGATTCAAAGAC...

Protein

Download Protein FASTA

1732 aa · LXL04_012832|LXL04_012832|OH1004|PROTEIN

MVADAVVDKEAEELQYSDSRTSYSACVEAVDMGSEAEIPEWASTPCIMGIDEAGRGPVLGPMVYGCLYCPVSYKKTLSTLEFADSKTLKEEKREELFESLKTDVTIGWAVDVIDPRDLSAKMLRKNKINLNEISHESAMGLVKRVLDMGYLLTEVYVDTVGDPEKYTVKLSARFPSIKFVVAKKADSLYPVVSGASIVAKVTRDRALRNWNFDETAENMHRVFGSGYPGDPGTKDWLKDHSHSVFGFPSLVRFSWGTCSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012832`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012832

Location Chr03:19506202-19517571 (+)

Description Similar to At2g25100: Ribonuclease H2 subunit A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25100`	Catalytic subunit of RNase HII, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012832 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0043137 DNA replication, removal of RNA primer Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0032299 ribonuclease H2 complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G25100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.434

Rank 1 · LXL04_012832 · OH-1004

Nucleus0.404

Rank 2 · LXL04_012832 · OH-1004

Cell membrane0.158

Rank 3 · LXL04_012832 · OH-1004

Endoplasmic reticulum0.085

Rank 4 · LXL04_012832 · OH-1004

Plastid0.056

Rank 5 · LXL04_012832 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01351.26RNase_HII48-258 aa

PF01582.26TIR335-498 aa

PF13676.12TIR_2337-432 aa

PF00931.29NB-ARC512-685 aa

PF23282.2WHD_ROQ1755-821 aa

PF03297.22Ribosomal_S251631-1729 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012832	`PF01351.26`	RNase_HII	48	258	1.9e-50	172.2
LXL04_012832	`PF01582.26`	TIR	335	498	1.8e-43	149.1
LXL04_012832	`PF13676.12`	TIR_2	337	432	9.5e-16	59.1
LXL04_012832	`PF00931.29`	NB-ARC	512	685	3e-21	76.4
LXL04_012832	`PF23282.2`	WHD_ROQ1	755	821	1.8e-13	51.2
LXL04_012832	`PF03297.22`	Ribosomal_S25	1631	1729	4.8e-39	133.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEZ6`	Arabidopsis thaliana	Ribonuclease H2 subunit A	73.404%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card