TkA02G535530 | RubberDandelionOmics

Gene overview

TkA02G535530

Reference: TK1151 Chr: Chr02 Coordinates: 138097073-138098479 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

897 bp · TkA02G535530|TK1151|cDNA

AAAACGGCCACCTAGAAGGCTAGAACTCCCTCAAAATTGTTTTGATACCAAAAACGAACTCTTTTATATAGTTCAGGGACAGAACTTTTCACAATTATCGTTGTTACGGTACATATCAACTTTGTGAAGGTGGAATCTGATGCTATTGGTAGCCAACACGACTGCTGATTCAGACTCCAAAGTTAAACGTAAATTAGAATCTCTCGTTTTTCCCTATTTTAATCGATTGCATTCCCTCACATTTCTACAATTGGAATTCA...

CDS

Download CDS FASTA

474 bp · TkA02G535530|TK1151|CDS

ATGTCTCAGACCGTCGTTCTCAAGGTTGCCATGTCATGTGGAGGCTGTGCTGGTGCCGTGAAGAGGGTTCTCACCAATATGGAAGGGGTGGAAACTTTTGACATTGACCTCGAGCAAAAAAAGGTAACAGTGAAAGGAAACGTAGACCCAGATGTGATTTTTCAGACCGTTTCCAAGACCGGGAAGAAGACGGAGTTTTGGCCGACGGAAGCGCCGTCATGTTGTGGAGGGAAGAAGTCGGAGGAGCCTGTTGCCGCGAC...

Protein

Download Protein FASTA

157 aa · TkA02G535530|TK1151|PROTEIN

MSQTVVLKVAMSCGGCAGAVKRVLTNMEGVETFDIDLEQKKVTVKGNVDPDVIFQTVSKTGKKTEFWPTEAPSCCGGKKSEEPVAATSSEGGETVEPVTAPSSVAGKPVDPVVAPPSEAAKPVDPVIAPSPETEKVVKPLAAAPSCEAEKPVETVVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G535530`
TK1151 ID	TkA02G535530
OH-1004 ID	LXL04_012848
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.631 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G535530

Location Chr02:138097073-138098479 (-)

Description Similar to CCH: Copper transport protein CCH

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56240`	Involved in copper homeostasis.	No verified direct reference in this release
`At1g66240`	Plays an important role in copper homeostasis by conferring tolerance to excess of copper and subclinical copper deficiency during vegetative stage.	No verified direct reference in this release
`At5g27690`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g02600`	Required for root meristem maintenance after germination.	Arabidopsis NPCC6/NaKR1 is a phloem mobile metal binding protein necessary for phloem function and root meristem maintenance.2010 · DOI: 10.1105/tpc.110.080010 NaKR1 regulates long-distance movement of FLOWERING LOCUS T in Arabidopsis.2016 · DOI: 10.1038/nplants.2016.75

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012848 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006825 copper ion transport Biological Process

GO:0006878 intracellular copper ion homeostasis Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0016531 copper chaperone activity Molecular Function

KEGG gene cross-reference

ath:AT1G66240

ath:AT3G56240

ath:AT3G56891

ath:AT5G27690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.694

Rank 1 · TkA02G535530 · TK1151

Nucleus0.246

Rank 2 · TkA02G535530 · TK1151

Cell membrane0.203

Rank 3 · TkA02G535530 · TK1151

Mitochondrion0.084

Rank 4 · TkA02G535530 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA02G535530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403HMA7-63 aa

PF20682Hanta_Gc_C8-70 aa

PF12673SipL20-66 aa

PF15096G6B52-99 aa

PF15096G6B102-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G535530	`PF00403`	HMA	7	63	7.4e-15	55.8
TkA02G535530	`PF20682`	Hanta_Gc_C	8	70	0.022	15.2
TkA02G535530	`PF12673`	SipL	20	66	0.16	12.9
TkA02G535530	`PF15096`	G6B	52	99	0.25	12.1
TkA02G535530	`PF15096`	G6B	102	130	0.25	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82089`	Arabidopsis thaliana	sp\|O82089\|CCH_ARATH Copper transport protein CCH	73.200%	Swiss-Prot	Low
`Q94BT9`	Arabidopsis thaliana	sp\|Q94BT9\|ATOX1_ARATH Copper transport protein ATX1	71.400%	Swiss-Prot	Low
`Q84J88`	Arabidopsis thaliana	sp\|Q84J88\|HIP36_ARATH Heavy metal-associated isoprenylated plant protein 36	43.900%	Swiss-Prot	Low
`Q8LDS4`	Arabidopsis thaliana	sp\|Q8LDS4\|NAKR1_ARATH Protein SODIUM POTASSIUM ROOT DEFECTIVE 1	47.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card