TkA02G530850 | RubberDandelionOmics

Gene overview

TkA02G530850

Reference: TK1151 Chr: Chr02 Coordinates: 136870049-136876077 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3438 bp · TkA02G530850|TK1151|cDNA

GTGAACTTCCGGTGATCACCCAAATGTCCATTCCCTGCCAATCATCTTATTCTTTCCTTCCTGCCATCATCTCCCCCACTCGTACTCCGCCCGCCCGATTTCACTTCCGTATACCCAACAAAAAGACCCGCCCAAATGGCTTCTCCACTCAACTAGGACATGGTCTTCCCCTCACCACGAAACGCAGAACAAGAACCCACCACAGTTACTGCTCAAGTTCAACAATGGCAGTCAAGGAACCCGCATCTTCACCCCTTCAG...

CDS

Download CDS FASTA

2781 bp · TkA02G530850|TK1151|CDS

ATGTCCATTCCCTGCCAATCATCTTATTCTTTCCTTCCTGCCATCATCTCCCCCACTCGTACTCCGCCCGCCCGATTTCACTTCCGTATACCCAACAAAAAGACCCGCCCAAATGGCTTCTCCACTCAACTAGGACATGGTCTTCCCCTCACCACGAAACGCAGAACAAGAACCCACCACAGTTACTGCTCAAGTTCAACAATGGCAGTCAAGGAACCCGCATCTTCACCCCTTCAGGATAGCCTATCCTACTCTCGAGC...

Protein

Download Protein FASTA

926 aa · TkA02G530850|TK1151|PROTEIN

MSIPCQSSYSFLPAIISPTRTPPARFHFRIPNKKTRPNGFSTQLGHGLPLTTKRRTRTHHSYCSSSTMAVKEPASSPLQDSLSYSRAYWVSRSLIAWNVDAVNGSCFLYSSTSAALSVTENGIEGSDFNIKLERHDQRLPENVKDKFPHIQDYNAFKIPTSLDPKSILKDQLAVAFFDSNGQCINVTGLQLPGVLDDIFSYTGPLGAIFLNESVSLHLWAPTAQDVRVFIYNGPTGGEPFEIVNLKESTVFGMLSGDGKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G530850`
TK1151 ID	TkA02G530850
OH-1004 ID	LXL04_012913
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 93.957 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G530850

Location Chr02:136870049-136876077 (+)

Description Similar to PU1: Pullulanase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04360`	Involved in starch degradation and also probably in the trimming of pre-amylopectin chains during starch synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012913 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0010303 limit dextrinase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0051060 pullulanase activity Molecular Function

KEGG gene cross-reference

ag:AAA25124

ath:AT5G04360

bsu:BSU29930

tma:TM1845

tmi:THEMA_04980

tmm:Tmari_1853

tmw:THMA_1888

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.835

Rank 1 · TkA02G530850 · TK1151

Cytoplasm0.085

Rank 2 · TkA02G530850 · TK1151

Mitochondrion0.055

Rank 3 · TkA02G530850 · TK1151

Peroxisome0.047

Rank 4 · TkA02G530850 · TK1151

Cell membrane0.044

Rank 5 · TkA02G530850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17967Pullulanase_N285-197 aa

PF02922CBM_48101-133 aa

PF02922CBM_48204-242 aa

PF00128Alpha-amylase420-444 aa

PF03662Glyco_hydro_79n433-482 aa

PF00128Alpha-amylase496-520 aa

PF00128Alpha-amylase675-727 aa

PF11852Pullul_strch_C751-920 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G530850	`PF17967`	Pullulanase_N2	85	197	8.8e-33	114.2
TkA02G530850	`PF02922`	CBM_48	101	133	0.073	14.1
TkA02G530850	`PF02922`	CBM_48	204	242	0.073	14.1
TkA02G530850	`PF00128`	Alpha-amylase	420	444	0.023	14.6
TkA02G530850	`PF03662`	Glyco_hydro_79n	433	482	0.21	11.3
TkA02G530850	`PF00128`	Alpha-amylase	496	520	0.023	14.6
TkA02G530850	`PF00128`	Alpha-amylase	675	727	0.023	14.6
TkA02G530850	`PF11852`	Pullul_strch_C	751	920	1.5e-62	210.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GTR4`	Arabidopsis thaliana	sp\|Q8GTR4\|PULA1_ARATH Pullulanase 1, chloroplastic	67.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card