TkA02G523170 | RubberDandelionOmics

Gene overview

TkA02G523170

Reference: TK1151 Chr: Chr02 Coordinates: 134914385-134917285 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1825 bp · TkA02G523170|TK1151|cDNA

TAGATAGTCTAAAATAAATTATTTCCCGCACGGCGTCATCCAAGACGGCGCAAAAGCTCGATGAAACGATGCTCAGAACAACAATGGCCGCTTTGTTTCACCACACCACCAAGCTATTCTCTTTACCCGTCAATGATGTCCTCTATCACTCCGTACATAAATCCCTGCGGTTTATAAGTCGCCCGAGCTACCCTCGAGCGGTCAGACCTATCTTCTCCATCAACACACCTCGTTCGATATCCTCCCACGCAGTTCCCAAA...

CDS

Download CDS FASTA

1392 bp · TkA02G523170|TK1151|CDS

ATGGCCGCTTTGTTTCACCACACCACCAAGCTATTCTCTTTACCCGTCAATGATGTCCTCTATCACTCCGTACATAAATCCCTGCGGTTTATAAGTCGCCCGAGCTACCCTCGAGCGCGCCCCCTCAAAGTGGCGGTTCTTCTCAGCGGCGGGGTTGATAGCAGCGTTGCACTTCGGCTCCTCCACGCAGCCGGACACTCCTGCACTGCTTTTTACCTTAAAATCTGGTTCCAGGAAGATTTCGAGAACTTTTGGTCCGA...

Protein

Download Protein FASTA

463 aa · TkA02G523170|TK1151|PROTEIN

MAALFHHTTKLFSLPVNDVLYHSVHKSLRFISRPSYPRARPLKVAVLLSGGVDSSVALRLLHAAGHSCTAFYLKIWFQEDFENFWSECPWEEDLKYAKAVVTGFECSIAIYLQICFQVDVPLEVVHLTDEYWDKVVSYLIDEYKCGRTPNPDVLCNTRIKFGAFMDAISNMNFDFVASGHYAKVVHPISDETNELSFLQLSKDMFKDQTYFLSYLSQAQLKRLVLPLGCIPKDEVRKLARKFDLPNQERKDSQGICFLGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G523170`
TK1151 ID	TkA02G523170
OH-1004 ID	LXL04_013011
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.100
Protein coverage (%)	TK1151 100.000 / OH-1004 98.992 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G523170`
Location	Chr02:134914385-134917285 (+)
Description	Similar to mnmA: tRNA-specific 2-thiouridylase MnmA (Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013011` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0005737 cytoplasm Cellular Component GO:0000049 tRNA binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0103016 tRNA-uridine 2-sulfurtransferase activity Molecular Function
KEGG gene cross-reference	baf:BAPKO_0726 bafz:BafPKo_0707 bbu:BB_0682 bbz:BbuZS7_0702 bhr:BH0682 btu:BT0682 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.725

Rank 1 · TkA02G523170 · TK1151

Plastid0.248

Rank 2 · TkA02G523170 · TK1151

Cytoplasm0.072

Rank 3 · TkA02G523170 · TK1151

Nucleus0.052

Rank 4 · TkA02G523170 · TK1151

Cell membrane0.015

Rank 5 · TkA02G523170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03054tRNA_Me_trans43-260 aa

PF00733Asn_synthase43-104 aa

PF02540NAD_synthase43-62 aa

PF06508QueC44-71 aa

PF06508QueC218-247 aa

PF02540NAD_synthase224-246 aa

PF20259tRNA_Me_trans_M265-326 aa

PF20258tRNA_Me_trans_C337-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G523170	`PF03054`	tRNA_Me_trans	43	260	2.4e-71	240.3
TkA02G523170	`PF00733`	Asn_synthase	43	104	0.017	15.5
TkA02G523170	`PF02540`	NAD_synthase	43	62	0.13	12.1
TkA02G523170	`PF06508`	QueC	44	71	0.099	12.8
TkA02G523170	`PF06508`	QueC	218	247	0.099	12.8
TkA02G523170	`PF02540`	NAD_synthase	224	246	0.13	12.1
TkA02G523170	`PF20259`	tRNA_Me_trans_M	265	326	5.4e-23	81.0
TkA02G523170	`PF20258`	tRNA_Me_trans_C	337	414	2e-16	60.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card