LXL04_013011 | RubberDandelionOmics

Gene overview

LXL04_013011

Reference: OH-1004 Chr: Chr03 Coordinates: 22222030-22224600 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1518 bp · LXL04_013011|LXL04_013011|OH1004|cDNA

AAGACGGCGCAAAAGCTCGATGAAACGATGCTCAGAACAACAATGGCCGCTTTGTTTCACCCCACCACCAAGCTATTAACTTTACCCGTCAATGATACCCTCTATCACTCCGTTCACAAATCCCTGCGGTTTATAAGTCGCCCAAGCTACACTCGACCAGTCAGACCTATCTTCTCCATCAACACACCTCGTTCGCTATCCTCCACAGCAGTTCCCCAAACTTTGAACGACCATGTTTCTGATTTGGACCACAATTACTT...

CDS

Download CDS FASTA

1491 bp · LXL04_013011|LXL04_013011|OH1004|CDS

ATGCTCAGAACAACAATGGCCGCTTTGTTTCACCCCACCACCAAGCTATTAACTTTACCCGTCAATGATACCCTCTATCACTCCGTTCACAAATCCCTGCGGTTTATAAGTCGCCCAAGCTACACTCGACCAGTCAGACCTATCTTCTCCATCAACACACCTCGTTCGCTATCCTCCACAGCAGTTCCCCAAACTTTGAACGACCATGTTTCTGATTTGGACCACAATTACTTATCTTGCTCAATGCCCAATAGCAAGCG...

Protein

Download Protein FASTA

496 aa · LXL04_013011|LXL04_013011|OH1004|PROTEIN

MLRTTMAALFHPTTKLLTLPVNDTLYHSVHKSLRFISRPSYTRPVRPIFSINTPRSLSSTAVPQTLNDHVSDLDHNYLSCSMPNSKRPLKVAVLLSGGVDSSVALRLLHAAGHSCTAFYLKIWFQEDFENFWSECPWEEDLKYAKAVCNQVDVPLEVVHLTDEYWDKVVSYLIDEYKCGRTPNPDVLCNTRIKFGAFMDAISNMNFDFVASGHYAKVVHPISDETNELSFLQLSKDMFKDQTYFLSYLSQAQLKRLVLPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013011`
TK1151 ID	TkA02G523170
OH-1004 ID	LXL04_013011
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.100
Protein coverage (%)	TK1151 100.000 / OH-1004 98.992 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_013011`
Location	Chr03:22222030-22224600 (-)
Description	Similar to mnmA: tRNA-specific 2-thiouridylase MnmA (Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013011` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0005737 cytoplasm Cellular Component GO:0000049 tRNA binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0103016 tRNA-uridine 2-sulfurtransferase activity Molecular Function
KEGG gene cross-reference	baf:BAPKO_0726 bafz:BafPKo_0707 bbu:BB_0682 bbz:BbuZS7_0702 bhr:BH0682 btu:BT0682 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.595

Rank 1 · LXL04_013011 · OH-1004

Plastid0.409

Rank 2 · LXL04_013011 · OH-1004

Nucleus0.046

Rank 3 · LXL04_013011 · OH-1004

Cytoplasm0.046

Rank 4 · LXL04_013011 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_013011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03054.23tRNA_Me_trans90-293 aa

PF20259.4tRNA_Me_trans_M298-359 aa

PF20258.5tRNA_Me_trans_C370-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013011	`PF03054.23`	tRNA_Me_trans	90	293	8.9e-77	258.0
LXL04_013011	`PF20259.4`	tRNA_Me_trans_M	298	359	6.1e-23	80.9
LXL04_013011	`PF20258.5`	tRNA_Me_trans_C	370	447	4.6e-16	59.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card