TkA02G522030 | RubberDandelionOmics

Gene overview

TkA02G522030

Reference: TK1151 Chr: Chr02 Coordinates: 134633629-134639581 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1485 bp · TkA02G522030|TK1151|cDNA

TATTAATTTACCAGACTCGTAACAACAATAATTCTATATAATGAATCCTCCCGCCATTAATCCTTTCCTTGTCTACGTTGTTGAAGTCAAATTAATTATTTGACTCGAAAAGTCAAATAAAATGCAGAGATTTGCCGGAGTCGTGAAATCCATCGTCGTGACTGCATCACGACGGAGAACAGCCGCCGCTTCCTTCTCAACCTCTTTGCTATTCGATGAAACCCAAATTAGGTTCAAAGAAGGTCTTCAGCAATTTGCCC...

CDS

Download CDS FASTA

1230 bp · TkA02G522030|TK1151|CDS

ATGCAGAGATTTGCCGGAGTCGTGAAATCCATCGTCGTGACTGCATCACGACGGAGAACAGCCGCCGCTTCCTTCTCAACCTCTTTGCTATTCGATGAAACCCAAATTAGGTTCAAAGAAGGTCTTCAGCAATTTGCCCAAGAGAAGATAGCTCCTCATGCAGACAAAATCGATAAGATGGATTCTTTCCCAGAGGATGTTAATTTATGGAAAGCGATGGGGGACTTCGATCTTCATGGACTTACTGCTCCAGTGGAATA...

Protein

Download Protein FASTA

409 aa · TkA02G522030|TK1151|PROTEIN

MQRFAGVVKSIVVTASRRRTAAASFSTSLLFDETQIRFKEGLQQFAQEKIAPHADKIDKMDSFPEDVNLWKAMGDFDLHGLTAPVEYGGLDVGYLYHCMAMEEISRASASVGVSYGVHSNVCLNQLVRHGNAAQKEKYLPKLISGDHVGALSISEPNAGSDAVGMKCKADRVDGGYVINGNKMWCTNGRIADTLVVYAKTDVSAGSKGITAFIIEKGTPGFIAAQKLDKLGMRGSGTCELVFENCFVPTENILGEVGKGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G522030`
TK1151 ID	TkA02G522030
OH-1004 ID	LXL04_013020
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.300
Protein coverage (%)	TK1151 99.267 / OH-1004 97.596 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G522030

Location Chr02:134633629-134639581 (-)

Description Similar to 2MBCD: 2-methylacyl-CoA dehydrogenase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45300`	Involved in degradation of the branched-chain amino acids, phytol and lysine for the supply of carbon and electrons to the ETF/ETFQO complex during dark-induced sugar starvation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0125500`	Isovaleryl-CoA dehydrogenase, mitochondrial.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013020 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0010230 alternative respiration Biological Process

GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process

GO:1902190 2-methylbutanoyl-CoA(4-) catabolic process Biological Process

GO:1902192 2-methylbut-2-enoyl-CoA(4-) metabolic process Biological Process

GO:1902196 isovaleryl-CoA(4-) catabolic process Biological Process

GO:1902198 3-methylbut-2-enoyl-CoA(4-) metabolic process Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G45300

dosa:Os05g0125500

mmu:56357

sot:102589539

sot:102601763

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.879

Rank 1 · TkA02G522030 · TK1151

Cytoplasm0.063

Rank 2 · TkA02G522030 · TK1151

Plastid0.036

Rank 3 · TkA02G522030 · TK1151

Nucleus0.028

Rank 4 · TkA02G522030 · TK1151

Peroxisome0.025

Rank 5 · TkA02G522030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02771Acyl-CoA_dh_N33-146 aa

PF02770Acyl-CoA_dh_M150-245 aa

PF11794HpaB_N171-253 aa

PF00441Acyl-CoA_dh_1257-405 aa

PF08028Acyl-CoA_dh_2272-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G522030	`PF02771`	Acyl-CoA_dh_N	33	146	1.1e-35	123.2
TkA02G522030	`PF02770`	Acyl-CoA_dh_M	150	245	4.3e-24	85.2
TkA02G522030	`PF11794`	HpaB_N	171	253	0.00078	19.8
TkA02G522030	`PF00441`	Acyl-CoA_dh_1	257	405	1.5e-42	146.0
TkA02G522030	`PF08028`	Acyl-CoA_dh_2	272	388	4.3e-11	44.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SWG0`	Arabidopsis thaliana	sp\|Q9SWG0\|IVD_ARATH Isovaleryl-CoA dehydrogenase, mitochondrial	74.800%	Swiss-Prot	High
`Q75IM9`	Oryza sativa subsp. japonica	sp\|Q75IM9\|IVD_ORYSJ Isovaleryl-CoA dehydrogenase, mitochondrial	78.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card