TkA02G518290 | RubberDandelionOmics

Gene overview

TkA02G518290

Reference: TK1151 Chr: Chr02 Coordinates: 133559370-133561844 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2318 bp · TkA02G518290|TK1151|cDNA

AATTAACTAAATTGATAAGAAAAAACTCTAAATAAATCATGCCACACAATTTTTAAGCCATATTGTACGTCTATTACTGGACATGCTTTGAGTTTTTGATGCTTAATGGAGACCCATATATATGCCTGACGTCTGTTCTTGAATTCCCCTTTTCGGTCTCTACTTTCCTTCTCGATTTCTTTTTCTATATGTTATTTCAACTTTACCTCTCATGCTACGCCTCCTTTCTTCATTCCAACTCGAAGGAAATTTCAGTCAAT...

CDS

Download CDS FASTA

633 bp · TkA02G518290|TK1151|CDS

ATGTTGAGAATATCGTCATCCCACCCTACATCTCGCCGGAGAAAGTTCAATCTGTACTGTCAACATCACCGATCACTGGTCGGCGCGACATTTCGTGTTTTTCCGGGGAAAATGGAAGTCCGCCCCAAGAACGTCAGCGGTCAATTTTACAGCAAGCGCGTGAGGACGGAGATACTGCGGAAGTACGGGCACGACCGGCGGTTCTACCTGAGAAGAAACCGATTCGCCGGATATCTGTCGGAAATCGTACGGTCAGTGTT...

Protein

Download Protein FASTA

210 aa · TkA02G518290|TK1151|PROTEIN

MLRISSSHPTSRRRKFNLYCQHHRSLVGATFRVFPGKMEVRPKNVSGQFYSKRVRTEILRKYGHDRRFYLRRNRFAGYLSEIVRSVFCLCPLGWAPWSPRLVESVALGCVPVIIADGIRLPFGTAVPWSEISLTVAESDIGKLGTILDYVAATNLSTIQRNLWDPRVQRALLYHDDVEVGDATWQILNALLSEKLGISDQKIYTRPSNSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G518290`
TK1151 ID	TkA02G518290
OH-1004 ID	LXL04_013088
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 85.714 / OH-1004 39.602 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G518290

Location Chr02:133559370-133561844 (+)

Description Similar to IRX7: Probable glucuronoxylan glucuronosyltransferase IRX7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28110`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	Arabidopsis fragile fiber8, which encodes a putative glucuronyltransferase, is essential for normal secondary wall synthesis.2005 · DOI: 10.1105/tpc.105.035501 The irregular xylem9 mutant is deficient in xylan xylosyltransferase activity.2007 · DOI: 10.1093/pcp/pcm135 Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis.2007 · DOI: 10.1111/j.1365-313x.2007.03307.x
`At5g22940`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0107900`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os01g0926400`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os01g0926600`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013088 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28110

ath:AT5G22940

dosa:Os01g0926400

dosa:Os01g0926700

dosa:Os03g0107900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.460

Rank 1 · TkA02G518290 · TK1151

Endoplasmic reticulum0.248

Rank 2 · TkA02G518290 · TK1151

Nucleus0.083

Rank 3 · TkA02G518290 · TK1151

Extracellular0.075

Rank 4 · TkA02G518290 · TK1151

Cytoplasm0.071

Rank 5 · TkA02G518290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016Exostosin_GT4733-149 aa

PF24785RXYLT1_C75-113 aa

PF24785RXYLT1_C183-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G518290	`PF03016`	Exostosin_GT47	33	149	3.5e-27	96.2
TkA02G518290	`PF24785`	RXYLT1_C	75	113	0.02	15.1
TkA02G518290	`PF24785`	RXYLT1_C	183	205	0.02	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUV3`	Arabidopsis thaliana	sp\|Q9ZUV3\|IRX7_ARATH Probable glucuronoxylan glucuronosyltransferase IRX7	74.500%	Swiss-Prot	High
`Q6NMM8`	Arabidopsis thaliana	sp\|Q6NMM8\|F8H_ARATH Probable glucuronoxylan glucuronosyltransferase F8H	70.700%	Swiss-Prot	High
`Q10SX7`	Oryza sativa subsp. japonica	sp\|Q10SX7\|GT31_ORYSJ Probable glucuronosyltransferase Os03g0107900	63.800%	Swiss-Prot	High
`Q8S1X9`	Oryza sativa subsp. japonica	sp\|Q8S1X9\|GT13_ORYSJ Probable glucuronosyltransferase Os01g0926400	46.500%	Swiss-Prot	Medium
`Q8S1X8`	Oryza sativa subsp. japonica	sp\|Q8S1X8\|GT14_ORYSJ Probable glucuronosyltransferase Os01g0926600	42.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card