LXL04_013088 | RubberDandelionOmics

Gene overview

LXL04_013088

Reference: OH-1004 Chr: Chr03 Coordinates: 23693374-23694885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_013088|LXL04_013088|OH1004|cDNA

ATGGAGGTTTTTGGATCAGCAAGGAATAGAAAGCAATTCTATGCGAGGATGAAGCTTTTAAGGAACAGACATGGAAAAACAGAGACACAGACGCCCTTTCGCTTTCGATACTTGAAATGGATTCTCTGGTTTTCTCTGTCGTTTTACTTCTTTGCTACGTCTCTCGGCAACCATCGTCCGGCGACGACGTCGTTAAAAACTATAATTCCTCAACCACAATTGCGTTCTGTCTCCCCTGTTCTCTCAGACACCGCAGTTCT...

CDS

Download CDS FASTA

1359 bp · LXL04_013088|LXL04_013088|OH1004|CDS

ATGGAGGTTTTTGGATCAGCAAGGAATAGAAAGCAATTCTATGCGAGGATGAAGCTTTTAAGGAACAGACATGGAAAAACAGAGACACAGACGCCCTTTCGCTTTCGATACTTGAAATGGATTCTCTGGTTTTCTCTGTCGTTTTACTTCTTTGCTACGTCTCTCGGCAACCATCGTCCGGCGACGACGTCGTTAAAAACTATAATTCCTCAACCACAATTGCGTTCTGTCTCCCCTGTTCTCTCAGACACCGCAGTTCT...

Protein

Download Protein FASTA

452 aa · LXL04_013088|LXL04_013088|OH1004|PROTEIN

MEVFGSARNRKQFYARMKLLRNRHGKTETQTPFRFRYLKWILWFSLSFYFFATSLGNHRPATTSLKTIIPQPQLRSVSPVLSDTAVLRQPRSLKDLRVYIYELPSKYNSDWLSNARCSNHLFASEVAIHKALMKSDARTFDPSVADFFFVPVYVSCNFSAVNGFPAIGHARGLLSSAVELISSELPFWNRSNGSDHIFVASHDFGACFHAMESKAVLDGIPEFMKNSIILQTFGVTYRHPCQDVENIVIPPYISPEKVQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013088`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013088

Location Chr03:23693374-23694885 (-)

Description Similar to IRX7: Probable glucuronoxylan glucuronosyltransferase IRX7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28110`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	Arabidopsis fragile fiber8, which encodes a putative glucuronyltransferase, is essential for normal secondary wall synthesis.2005 · DOI: 10.1105/tpc.105.035501 The irregular xylem9 mutant is deficient in xylan xylosyltransferase activity.2007 · DOI: 10.1093/pcp/pcm135 Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis.2007 · DOI: 10.1111/j.1365-313x.2007.03307.x
`At5g22940`	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0107900`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os01g0926700`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release
`Os01g0926400`	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013088 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28110

ath:AT5G22940

dosa:Os01g0926400

dosa:Os01g0926700

dosa:Os03g0107900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.836

Rank 1 · LXL04_013088 · OH-1004

Endoplasmic reticulum0.065

Rank 2 · LXL04_013088 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_013088 · OH-1004

Extracellular0.038

Rank 4 · LXL04_013088 · OH-1004

Nucleus0.037

Rank 5 · LXL04_013088 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016.21Exostosin_GT4794-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013088	`PF03016.21`	Exostosin_GT47	94	392	4.5e-71	240.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUV3`	Arabidopsis thaliana	Probable glucuronoxylan glucuronosyltransferase IRX7	60.317%	Swiss-Prot	strong database homology
`Q6NMM8`	Arabidopsis thaliana	Probable glucuronoxylan glucuronosyltransferase F8H	61.017%	Swiss-Prot	strong database homology
`Q10SX7`	Oryza sativa subsp. japonica	Probable glucuronosyltransferase Os03g0107900	53.234%	Swiss-Prot	strong database homology
`Q8S1X7`	Oryza sativa subsp. japonica	Probable glucuronosyltransferase Os01g0926700	42.063%	Swiss-Prot	moderate database homology
`Q8S1X9`	Oryza sativa subsp. japonica	Probable glucuronosyltransferase Os01g0926400	43.149%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card