RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G517660
Reference: TK1151 Chr: Chr02 Coordinates: 133392227-133392924 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

567 bp · TkA02G517660|TK1151|cDNA

ATGACTTCCAGTTCTGACAAGCTTCTACTGCCCTTACCCACCAAATCTACAACCCCAAAATCCGCGATTCCGATAAAAAAATCAAAGAAATGCACTACCACCGGTGACCATGATCATCGTTTGCATAATTCCGTCGATAATACCACTAGCACCAGTCCAAATTCATTGGCGGTTAAGTACTCATCGGCGGCAATTGTTGATTCTCCGGGTAGTATAGCGGCGGCAAGGAGGGAACAGGTGGCGGTGATGCAGGTTCAGAG...

CDS

Download CDS FASTA

567 bp · TkA02G517660|TK1151|CDS

ATGACTTCCAGTTCTGACAAGCTTCTACTGCCCTTACCCACCAAATCTACAACCCCAAAATCCGCGATTCCGATAAAAAAATCAAAGAAATGCACTACCACCGGTGACCATGATCATCGTTTGCATAATTCCGTCGATAATACCACTAGCACCAGTCCAAATTCATTGGCGGTTAAGTACTCATCGGCGGCAATTGTTGATTCTCCGGGTAGTATAGCGGCGGCAAGGAGGGAACAGGTGGCGGTGATGCAGGTTCAGAG...

Protein

Download Protein FASTA

188 aa · TkA02G517660|TK1151|PROTEIN

MTSSSDKLLLPLPTKSTTPKSAIPIKKSKKCTTTGDHDHRLHNSVDNTTSTSPNSLAVKYSSAAIVDSPGSIAAARREQVAVMQVQRKMRIAHYGRSKSAKYDSCSKLTSYNFDLNSLTPAIVREEKRCSFITPNSAVGTINSLPDQDDIHHRPYSPPPLLTLTMKTQSRLTHPNLHKSRTNITKTSP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G517660
TK1151 IDTkA02G517660
OH-1004 IDLXL04_021291
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)95.500
Protein coverage (%)TK1151 93.617 / OH-1004 16.907
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G517660
LocationChr02:133392227-133392924 (-)
DescriptionSimilar to CALS9: Callose synthase 9
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021291 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006075 (1->3)-beta-D-glucan biosynthetic process Biological Process
GO:0008360 regulation of cell shape Biological Process
GO:0009555 pollen development Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0009846 pollen germination Biological Process
GO:0048589 developmental growth Biological Process
GO:0051592 response to calcium ion Biological Process
GO:0052543 callose deposition in cell wall Biological Process
GO:0055047 generative cell mitosis Biological Process
GO:0071555 cell wall organization Biological Process
GO:0080092 regulation of pollen tube growth Biological Process
GO:2000767 positive regulation of cytoplasmic translation Biological Process
KEGG gene cross-reference
ath:AT2G31960
ath:AT2G36850
ath:AT3G07160
ath:AT5G13000
sce:YNL255C
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503
Rank 1 · TkA02G517660 · TK1151
Nucleus0.339
Rank 2 · TkA02G517660 · TK1151
Cell membrane0.164
Rank 3 · TkA02G517660 · TK1151
Mitochondrion0.059
Rank 4 · TkA02G517660 · TK1151
Endoplasmic reticulum0.033
Rank 5 · TkA02G517660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser