TkA02G509500 | RubberDandelionOmics

Gene overview

TkA02G509500

Reference: TK1151 Chr: Chr02 Coordinates: 130753367-130754012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · TkA02G509500|TK1151|cDNA

TACCTAGCACCAGAATATTCGACTACATGTCATCTGTCATCTAAGGCTGATGTTTTTAGTTTCGGTGTTCTGATTTTTGAAATCATAAGTGGGTATAGAATATTTGACTATGTGCCCGCCAACAACATGTCCATATTAGAAGAAGTTTCCAGTTATTGGTTGGAAGGAAGGTGTTCAGATATAATTGATTCTAGAATTCGTGCTGATTCAAGCATTATAACAAGATTCATCCATATTGGGTTGCTTTGTGTTCAATTATA...

CDS

Download CDS FASTA

537 bp · TkA02G509500|TK1151|CDS

TACCTAGCACCAGAATATTCGACTACATGTCATCTGTCATCTAAGGCTGATGTTTTTAGTTTCGGTGTTCTGATTTTTGAAATCATAAGTGGGTATAGAATATTTGACTATGTGCCCGCCAACAACATGTCCATATTAGAAGAAGTTTCCAGTTATTGGTTGGAAGGAAGGTGTTCAGATATAATTGATTCTAGAATTCGTGCTGATTCAAGCATTATAACAAGATTCATCCATATTGGGTTGCTTTGTGTTCAATTATA...

Protein

Download Protein FASTA

178 aa · TkA02G509500|TK1151|PROTEIN

YLAPEYSTTCHLSSKADVFSFGVLIFEIISGYRIFDYVPANNMSILEEVSSYWLEGRCSDIIDSRIRADSSIITRFIHIGLLCVQLYQADRPTMEEVVGMLTDSSSRTLPVPKIYLSHWMLEEYKVRTNVVRTNVVHTDAVYTDTSYTDLAYTAYLDQLLADYDHGAVLDFISELDPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G509500`
TK1151 ID	TkA02G509500
OH-1004 ID	LXL04_024870
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 88.177 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G509500

Location Chr02:130753367-130754012 (-)

Description Similar to At4g00960: Putative receptor-like protein kinase At4g00960

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61370`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370.	No verified direct reference in this release
`At4g00960`	Cysteine-rich receptor-like protein kinase 44.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g03230`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230.	No verified direct reference in this release
`At1g61440`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024870 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G61370

ath:AT4G00960

ath:AT4G11470

ath:AT4G23250

ath:AT4G23260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.550

Rank 1 · TkA02G509500 · TK1151

Nucleus0.285

Rank 2 · TkA02G509500 · TK1151

Cell membrane0.223

Rank 3 · TkA02G509500 · TK1151

Lysosome / Vacuole0.077

Rank 4 · TkA02G509500 · TK1151

Golgi apparatus0.068

Rank 5 · TkA02G509500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr1-99 aa

PF00069Pkinase1-98 aa

PF07714PK_Tyr_Ser-Thr120-144 aa

PF00069Pkinase120-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G509500	`PF07714`	PK_Tyr_Ser-Thr	1	99	1.8e-07	31.5
TkA02G509500	`PF00069`	Pkinase	1	98	3.3e-07	30.7
TkA02G509500	`PF07714`	PK_Tyr_Ser-Thr	120	144	1.8e-07	31.5
TkA02G509500	`PF00069`	Pkinase	120	150	3.3e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64783`	Arabidopsis thaliana	sp\|O64783\|Y1137_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370	38.800%	Swiss-Prot	Medium
`O23082`	Arabidopsis thaliana	sp\|O23082\|CRK44_ARATH Cysteine-rich receptor-like protein kinase 44	44.400%	Swiss-Prot	Medium
`O81905`	Arabidopsis thaliana	sp\|O81905\|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8	45.400%	Swiss-Prot	Medium
`Q9ZR08`	Arabidopsis thaliana	sp\|Q9ZR08\|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230	38.800%	Swiss-Prot	Medium
`O64776`	Arabidopsis thaliana	sp\|O64776\|Y1144_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61440	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card