TkA02G505870 | RubberDandelionOmics

Gene overview

TkA02G505870

Reference: TK1151 Chr: Chr02 Coordinates: 129786398-129788258 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

807 bp · TkA02G505870|TK1151|cDNA

ATGTGGTTGGTCCCTTCTCCCTCCACGCCGTCTCTAGTCGCTCCCATCAGTTCCTCCGTATTCATCGACTCTACCTCTTTCGCCAAAGATAGACGCAAGATTCATATTGGTGACTGTGCACTATTCAAGCCACCCCAGAATTCCCCTCCATCTATAGCAATAATCCGTAGATTAATAGTAGATAAAGAAGATAATTTAATTCTGAGTGTGAATTTGCTATACCGCCCTTGTGACGTAAAGCTTTTAAAAGGTGCATCTCC...

CDS

Download CDS FASTA

807 bp · TkA02G505870|TK1151|CDS

ATGTGGTTGGTCCCTTCTCCCTCCACGCCGTCTCTAGTCGCTCCCATCAGTTCCTCCGTATTCATCGACTCTACCTCTTTCGCCAAAGATAGACGCAAGATTCATATTGGTGACTGTGCACTATTCAAGCCACCCCAGAATTCCCCTCCATCTATAGCAATAATCCGTAGATTAATAGTAGATAAAGAAGATAATTTAATTCTGAGTGTGAATTTGCTATACCGCCCTTGTGACGTAAAGCTTTTAAAAGGTGCATCTCC...

Protein

Download Protein FASTA

268 aa · TkA02G505870|TK1151|PROTEIN

MWLVPSPSTPSLVAPISSSVFIDSTSFAKDRRKIHIGDCALFKPPQNSPPSIAIIRRLIVDKEDNLILSVNLLYRPCDVKLLKGASPEAAPNEEQQEVVDQLLDKTRVEMYGGHSPKTLNGPGPNGHTNKGGLVDFEGVEKIIQLMQPESGDKKVDLASRIMLVNVISGTDSSECLGRFVQLRGLLILDEWLQEFHKGKSVNHLRSHKNPEIIKKAKTLVDTWKKSVEAEMNMMERKRVEQMNIIETRSGTRRAGGFGSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G505870`
TK1151 ID	TkA02G505870
OH-1004 ID	LXL04_013316
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.800
Protein coverage (%)	TK1151 98.881 / OH-1004 33.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G505870`
Location	Chr02:129786398-129788258 (+)
Description	Similar to ppp1r10: Serine/threonine-protein phosphatase 1 regulatory subunit 10
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013316` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0010220 positive regulation of vernalization response Biological Process GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component GO:0001217 DNA-binding transcription repressor activity Molecular Function GO:0003682 chromatin binding Molecular Function GO:0061628 histone H3K27me3 reader activity Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	bdi:100843157 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.692

Rank 1 · TkA02G505870 · TK1151

Cytoplasm0.318

Rank 2 · TkA02G505870 · TK1151

Cell membrane0.045

Rank 3 · TkA02G505870 · TK1151

Mitochondrion0.043

Rank 4 · TkA02G505870 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA02G505870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01426BAH33-84 aa

PF16186Arm_3136-147 aa

PF01426BAH196-245 aa

PF08711Med26198-227 aa

PF16186Arm_3202-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G505870	`PF01426`	BAH	33	84	1.7e-05	25.4
TkA02G505870	`PF16186`	Arm_3	136	147	0.015	15.6
TkA02G505870	`PF01426`	BAH	196	245	1.7e-05	25.4
TkA02G505870	`PF08711`	Med26	198	227	2e-07	31.4
TkA02G505870	`PF16186`	Arm_3	202	234	0.015	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card