LXL04_013316 | RubberDandelionOmics

Gene overview

LXL04_013316

Reference: OH-1004 Chr: Chr03 Coordinates: 27603148-27607362 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3549 bp · LXL04_013316|LXL04_013316|OH1004|cDNA

ATGTATGGGCGGTGCGAAGGTGAGCTGTGGTTACACCGTCGGCACATGTGGTTGGTCCCTTCTCCCTCCACGCCGTCTCTAGTCGCTCCCATCAGTTCCTCCGTATTCATCGACTCTACCTCTTTCGCCAAAGATAGACGCAAGATTCATATTGGTGACTGTGCACTATTCAAGCCACCCCAGAATTCCCCTCCATCTATAGCAATAATCCGTAGATTAATAGTAGATAAAGAAGATAATTTAATTCTGAGTGTGAATTG...

CDS

Download CDS FASTA

3549 bp · LXL04_013316|LXL04_013316|OH1004|CDS

ATGTATGGGCGGTGCGAAGGTGAGCTGTGGTTACACCGTCGGCACATGTGGTTGGTCCCTTCTCCCTCCACGCCGTCTCTAGTCGCTCCCATCAGTTCCTCCGTATTCATCGACTCTACCTCTTTCGCCAAAGATAGACGCAAGATTCATATTGGTGACTGTGCACTATTCAAGCCACCCCAGAATTCCCCTCCATCTATAGCAATAATCCGTAGATTAATAGTAGATAAAGAAGATAATTTAATTCTGAGTGTGAATTG...

Protein

Download Protein FASTA

1182 aa · LXL04_013316|LXL04_013316|OH1004|PROTEIN

MYGRCEGELWLHRRHMWLVPSPSTPSLVAPISSSVFIDSTSFAKDRRKIHIGDCALFKPPQNSPPSIAIIRRLIVDKEDNLILSVNWLYRPCDVKLLKGASPEAAPNEVFYSFHQVEISAASLLHPCIVSFLHKGVELPPSVSSFVCRRVYDIETKCLLRLNNQDYSNEQQEVVDQLLDKTRVEMYGGHSPKTLNGPGPNGTTQVKGKKREQSSDPGQLRPEDMLKAEIARITDKGGLVDFEGVEKIIQLMQPESGDKKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013316`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013316

Location Chr03:27603148-27607362 (-)

Description Similar to ppp1r10: Serine/threonine-protein phosphatase 1 regulatory subunit 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11560`	Transcriptional repressor.	A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114 Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.2020 · DOI: 10.1038/s41467-020-20089-0 A histone H3K27me3 reader cooperates with a family of PHD finger-containing proteins to regulate flowering time in Arabidopsis.2021 · DOI: 10.1111/jipb.13067

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0001217 DNA-binding transcription repressor activity Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0061628 histone H3K27me3 reader activity Molecular Function

GO:0140566 histone reader activity Molecular Function

KEGG gene cross-reference

bdi:100843157

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_013316 · OH-1004

Cytoplasm0.081

Rank 2 · LXL04_013316 · OH-1004

Cell membrane0.036

Rank 3 · LXL04_013316 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_013316 · OH-1004

Plastid0.015

Rank 5 · LXL04_013316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01426.25BAH48-158 aa

PF08711.17Med26323-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013316	`PF01426.25`	BAH	48	158	6.3e-14	52.6
LXL04_013316	`PF08711.17`	Med26	323	372	3.6e-14	53.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXT5`	Arabidopsis thaliana	ASI1-immunoprecipitated protein 3	32.258%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card