Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1798 bp · TkA02G503670|TK1151|cDNA
ATCATGTGTCTTCCACTTTCCAATCTGTAAAGCTTCCAACAGGGTGTAAAGCTTCACTCCTTTCACCAAAAGGAGTAAAGCACTTCAGCAAATACCCATGCCCACAAAGAAGGCGTAAGCCATCCATGGTCAACCCCCAAAAGGCATAAGCCTCTTCATGTTCCAAACAAAACAAAGAAGACGTAAGGCATTCATGCCTTGACAAAAAAGGAGTAAGGAGTAAGGACTCCATACCTTGACCAAAAAAAGGAGTAAAAAAG...
816 bp · TkA02G503670|TK1151|CDS
ATGGGCGTCGTTATAATCTCTCCTTTTATCATCAAGTTATGCCACATGTTTTCGTTTCTTACAAAACTGCAGGGTCCAATCATACAGATTTTAAGTATTGATAAACTGTTAGAAGGAATAACTTCCTTTTACTCACTTATCGATTACCGTGAAAGAATTACCAGCATGCGATTGTTTCCTCTAAAAGAAACAACAATATTACGGGATAAAACAGAAGTAAACGATAATGTTTTAGTTACATCAAGCTGTGATAACTCAAT...
Protein
Download Protein FASTA271 aa · TkA02G503670|TK1151|PROTEIN
MGVVIISPFIIKLCHMFSFLTKLQGPIIQILSIDKLLEGITSFYSLIDYRERITSMRLFPLKETTILRDKTEVNDNVLVTSSCDNSIRIWWRGSCQRLFRDHKGAVTILSDKLLGDGSGKVFASGGEDTTVRIWSLSSRKKRDPHALKATLYGHEKPLVFMAVTGHNSSLLTTMSTDSMVRVWDTTVSSDHSSCCVGMTSVHGAPVGIKCHDSLVYIASGSSFEAVDLRTMKTAFKTSTNQANLFSFEIMPAKFLACTGG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G503670 |
|---|---|
| TK1151 ID | TkA02G503670 |
| OH-1004 ID | LXL04_013346 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.900 |
| Protein coverage (%) | TK1151 96.679 / OH-1004 58.744Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G503670 |
|---|---|
| Location | Chr02:129172694-129176170 (+) |
| Description | Similar to Taf5l: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006282 regulation of DNA repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0008593 regulation of Notch signaling pathway Biological Process GO:0010826 negative regulation of centrosome duplication Biological Process GO:0030154 cell differentiation Biological Process GO:0031647 regulation of protein stability Biological Process GO:0043484 regulation of RNA splicing Biological Process GO:0045746 negative regulation of Notch signaling pathway Biological Process |
| KEGG gene cross-reference | ath:AT5G25150 cel:CELE_F55B12.3 ddi:DDB_G0287273 hsa:27097 mmu:102162 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25173Beta-prop_WDR3_1st45-90 aaPF25178Beta-prop_WDR4146-98 aaPF30151PAC1158-100 aaPF24782WD40_MABP1-WDR62_2nd69-93 aaPF24807WD40_CDC20-Fz71-191 aaPF25048Beta-prop_TEP1_C72-98 aaPF25168Beta-prop_WDR36-Utp21_2nd72-90 aaPF25173Beta-prop_WDR3_1st73-222 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G503670 | PF25173 | Beta-prop_WDR3_1st | 45 | 90 | 6.2e-14 | 52.8 |
| TkA02G503670 | PF25178 | Beta-prop_WDR41 | 46 | 98 | 0.0052 | 16.3 |
| TkA02G503670 | PF30151 | PAC11 | 58 | 100 | 0.091 | 12.3 |
| TkA02G503670 | PF24782 | WD40_MABP1-WDR62_2nd | 69 | 93 | 2e-05 | 24.5 |
| TkA02G503670 | PF24807 | WD40_CDC20-Fz | 71 | 191 | 9.5e-08 | 32.4 |
| TkA02G503670 | PF25048 | Beta-prop_TEP1_C | 72 | 98 | 1.2e-05 | 25.9 |
| TkA02G503670 | PF25168 | Beta-prop_WDR36-Utp21_2nd | 72 | 90 | 0.053 | 13.5 |
| TkA02G503670 | PF25173 | Beta-prop_WDR3_1st | 73 | 222 | 6.2e-14 | 52.8 |
| TkA02G503670 | PF24814 | WD40_Prp19 | 73 | 110 | 3.2e-13 | 50.1 |
| TkA02G503670 | PF25175 | Beta-prop_WDR5 | 73 | 108 | 8e-13 | 49.0 |
| TkA02G503670 | PF29630 | ASA1 | 73 | 90 | 0.00033 | 20.4 |
| TkA02G503670 | PF23775 | Beta-prop_RIG_2nd | 73 | 90 | 0.00065 | 19.9 |
| TkA02G503670 | PF25174 | Beta-prop_THOC3 | 74 | 90 | 7.7e-18 | 65.2 |
| TkA02G503670 | PF00400 | WD40 | 74 | 90 | 1.5e-12 | 48.2 |
| TkA02G503670 | PF24817 | WD40_WDHD1_1st | 74 | 141 | 1.2e-08 | 35.2 |
| TkA02G503670 | PF25047 | Beta-prop_TEP1_2nd | 74 | 202 | 3e-08 | 33.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.