LXL04_013346 | RubberDandelionOmics

Gene overview

LXL04_013346

Reference: OH-1004 Chr: Chr03 Coordinates: 28176807-28179741 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1341 bp · LXL04_013346|LXL04_013346|OH1004|cDNA

ATGGTTTTCACATCCCAACAACCACTTTTAAATCGCACTTCATTTTTTACTATTTATATGGGCGTCGTTATAACCTCTCCTTTTATCATCAAGTTATGCCACATGTTTTCGTTTCTTACAAAACTGCAGGGTCCAATCATACAAATTTTAAGTATTGATAAACTGTTAGAAGGAATAACTTCCTTTTACTCACTTATCGATCACCGTGAAAGAATTACCAGCATGCGATTGTTTCCTCTaaaagaaacaacaatattACG...

CDS

Download CDS FASTA

1341 bp · LXL04_013346|LXL04_013346|OH1004|CDS

ATGGTTTTCACATCCCAACAACCACTTTTAAATCGCACTTCATTTTTTACTATTTATATGGGCGTCGTTATAACCTCTCCTTTTATCATCAAGTTATGCCACATGTTTTCGTTTCTTACAAAACTGCAGGGTCCAATCATACAAATTTTAAGTATTGATAAACTGTTAGAAGGAATAACTTCCTTTTACTCACTTATCGATCACCGTGAAAGAATTACCAGCATGCGATTGTTTCCTCTAAAAGAAACAACAATATTACG...

Protein

Download Protein FASTA

446 aa · LXL04_013346|LXL04_013346|OH1004|PROTEIN

MVFTSQQPLLNRTSFFTIYMGVVITSPFIIKLCHMFSFLTKLQGPIIQILSIDKLLEGITSFYSLIDHRERITSMRLFPLKETTILRDKTEVNDNVLVTSSCDNSIRIWWRGSCQRLFRGHKGAVTILSDKLLGDGSGKVFASGGEDTTVRIWSLSSRKKRDPHALKATLYGHEKPLVFMAVTGHNSSLLTTMSTDSMVRVWDTTVSSDHSSCCVGMTSVHGAPVGIKCHDSLVYIASGSSFEAVDLRTMKTAFKTSTNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013346`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013346

Location Chr03:28176807-28179741 (-)

Description Similar to Taf5l: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25150`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013346 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006282 regulation of DNA repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0008593 regulation of Notch signaling pathway Biological Process

GO:0010826 negative regulation of centrosome duplication Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0045746 negative regulation of Notch signaling pathway Biological Process

KEGG gene cross-reference

ath:AT5G25150

cel:CELE_F55B12.3

ddi:DDB_G0287273

hsa:27097

mmu:102162

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.454

Rank 1 · LXL04_013346 · OH-1004

Cytoplasm0.368

Rank 2 · LXL04_013346 · OH-1004

Mitochondrion0.095

Rank 3 · LXL04_013346 · OH-1004

Endoplasmic reticulum0.078

Rank 4 · LXL04_013346 · OH-1004

Cell membrane0.074

Rank 5 · LXL04_013346 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz90-210 aa

PF24814.2WD40_Prp1992-159 aa

PF24817.2WD40_WDHD1_1st93-160 aa

PF25047.1Beta-prop_TEP1_2nd93-221 aa

PF25172.2Beta-prop_WDR3_2nd94-205 aa

PF23381.2Beta-prop_IFT122_1st95-204 aa

PF25173.2Beta-prop_WDR3_1st112-241 aa

PF00400.39WD40112-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013346	`PF24807.2`	WD40_CDC20-Fz	90	210	7e-09	36.1
LXL04_013346	`PF24814.2`	WD40_Prp19	92	159	4.7e-15	56.1
LXL04_013346	`PF24817.2`	WD40_WDHD1_1st	93	160	1.6e-11	44.7
LXL04_013346	`PF25047.1`	Beta-prop_TEP1_2nd	93	221	6.5e-08	32.8
LXL04_013346	`PF25172.2`	Beta-prop_WDR3_2nd	94	205	2.5e-09	37.5
LXL04_013346	`PF23381.2`	Beta-prop_IFT122_1st	95	204	7.3e-10	39.4
LXL04_013346	`PF25173.2`	Beta-prop_WDR3_1st	112	241	2.3e-19	70.6
LXL04_013346	`PF00400.39`	WD40	112	154	1e-14	55.0
LXL04_013346	`PF25174.2`	Beta-prop_THOC3	137	273	6e-21	75.4
LXL04_013346	`PF25175.2`	Beta-prop_WDR5	137	253	3e-16	60.3
LXL04_013346	`PF24814.2`	WD40_Prp19	138	260	4.7e-15	56.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6S7B0`	Arabidopsis thaliana	Transcription initiation factor TFIID subunit 5	31.915%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card