Gene Card
Gene overview
cDNA / CDS / Protein Sequences
408 bp · TkA02G493830|TK1151|cDNA
ATGTTTGATCACGAGAGCCAATCAGTGAATTGGATGGCTCAAAGAGCTAAAGAGAAAGGCGCAAATGTTCAAAGCGCTTGGTTTAAATGGCCGACGCTTAAGCCATGTTCGACGCATTTGAGAAAACTGATTTTAAGTAGAAAAAAGAGGAAGAAAGATTCATCTACAGGGCTATTTGTGTTTCCTGTTCAATCGAGAGTTACTGGTGCAAAATATTCGTATCAATGGATGTCATTCGCACAGCAAAACAACTGGCATGT...
408 bp · TkA02G493830|TK1151|CDS
ATGTTTGATCACGAGAGCCAATCAGTGAATTGGATGGCTCAAAGAGCTAAAGAGAAAGGCGCAAATGTTCAAAGCGCTTGGTTTAAATGGCCGACGCTTAAGCCATGTTCGACGCATTTGAGAAAACTGATTTTAAGTAGAAAAAAGAGGAAGAAAGATTCATCTACAGGGCTATTTGTGTTTCCTGTTCAATCGAGAGTTACTGGTGCAAAATATTCGTATCAATGGATGTCATTCGCACAGCAAAACAACTGGCATGT...
Protein
Download Protein FASTA135 aa · TkA02G493830|TK1151|PROTEIN
MFDHESQSVNWMAQRAKEKGANVQSAWFKWPTLKPCSTHLRKLILSRKKRKKDSSTGLFVFPVQSRVTGAKYSYQWMSFAQQNNWHVLLDAGALGPLDMDSLGLSLFRPDFIITSFIKFLGTILLDSDAFLSRNL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G493830 |
|---|---|
| TK1151 ID | TkA02G493830 |
| OH-1004 ID | LXL04_013493 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 95.900 |
| Protein coverage (%) | TK1151 89.630 / OH-1004 15.125Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G493830 |
|---|---|
| Location | Chr02:126257864-126258271 (+) |
| Description | Similar to FLACCA: Molybdenum cofactor sulfurase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009651 response to salt stress Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009749 response to glucose Biological Process GO:0010118 stomatal movement Biological Process GO:0010182 sugar mediated signaling pathway Biological Process GO:0018315 molybdenum incorporation into molybdenum-molybdopterin complex Biological Process GO:0042742 defense response to bacterium Biological Process |
| KEGG gene cross-reference | aag:5575262 ath:AT1G16540 sly:543832 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.