LXL04_013493 | RubberDandelionOmics

Gene overview

LXL04_013493

Reference: OH-1004 Chr: Chr03 Coordinates: 30437487-30441491 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2403 bp · LXL04_013493|LXL04_013493|OH1004|cDNA

ATGACCCGTAAGGATGCATCATCCAAAGATTTGTTCACTACAAAACTTGAAACCTCATGCTTTTATGAAAGCAAAGCTTCATGTGGAAGAAAAGATCGGTCTAATCAACCCATCCAAAGAAACCCATCAGAGATTAGAAAATTGCAAGAAAACAAACTCAAAGCTGCTCTTCAACAAGCATCCGAATATGGATCCCTCGTTAAACCCCAATACAATGATGTTTCAGAGTCCATTGAAACGGAAAACAAGGATTTGGGAAG...

CDS

Download CDS FASTA

2403 bp · LXL04_013493|LXL04_013493|OH1004|CDS

ATGACCCGTAAGGATGCATCATCCAAAGATTTGTTCACTACAAAACTTGAAACCTCATGCTTTTATGAAAGCAAAGCTTCATGTGGAAGAAAAGATCGGTCTAATCAACCCATCCAAAGAAACCCATCAGAGATTAGAAAATTGCAAGAAAACAAACTCAAAGCTGCTCTTCAACAAGCATCCGAATATGGATCCCTCGTTAAACCCCAATACAATGATGTTTCAGAGTCCATTGAAACGGAAAACAAGGATTTGGGAAG...

Protein

Download Protein FASTA

800 aa · LXL04_013493|LXL04_013493|OH1004|PROTEIN

MTRKDASSKDLFTTKLETSCFYESKASCGRKDRSNQPIQRNPSEIRKLQENKLKAALQQASEYGSLVKPQYNDVSESIETENKDLGRSRSLARLQAQKEFLKATSLAADTTFETQNSIPDLHQAFAKFQTMYPRYTSSQKIDQLRVDEYQHLVDDDSKVCLDYCGFGLFSFLQFVNYWESCSISLSEITSNLGNHALFGGREKGTVEYDIKARIMDYLNIPESEYGLVFTVSRGSAFKLLAESYPFHTNKKLLTMFDHES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013493`
TK1151 ID	TkA02G493830
OH-1004 ID	LXL04_013493
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.900
Protein coverage (%)	TK1151 89.630 / OH-1004 15.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013493

Location Chr03:30437487-30441491 (-)

Description Similar to FLACCA: Molybdenum cofactor sulfurase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16540`	Sulfurates the molybdenum cofactor.	The Arabidopsis LOS5/ABA3 locus encodes a molybdenum cofactor sulfurase and modulates cold stress- and osmotic stress-responsive gene expression.2001 · DOI: 10.1105/tpc.010101 ABA3 is a molybdenum cofactor sulfurase required for activation of aldehyde oxidase and xanthine dehydrogenase in Arabidopsis thaliana.2001 · DOI: 10.1074/jbc.c100472200 Tandem orientation of duplicated xanthine dehydrogenase genes from Arabidopsis thaliana: differential gene expression and enzyme activities.2004 · DOI: 10.1074/jbc.m312929200 Characterization of the NifS-like domain of ABA3 from Arabidopsis thaliana provides insight into the mechanism of molybdenum cofactor sulfuration.2005 · DOI: 10.1074/jbc.m411195200 Binding of sulfurated molybdenum cofactor to the C-terminal domain of ABA3 from Arabidopsis thaliana provides insight into the mechanism of molybdenum cofactor sulfuration.2008 · DOI: 10.1074/jbc.m708549200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013493 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009749 response to glucose Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0018315 molybdenum incorporation into molybdenum-molybdopterin complex Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

aag:5575262

ath:AT1G16540

sly:543832

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · LXL04_013493 · OH-1004

Nucleus0.378

Rank 2 · LXL04_013493 · OH-1004

Cell membrane0.118

Rank 3 · LXL04_013493 · OH-1004

Golgi apparatus0.086

Rank 4 · LXL04_013493 · OH-1004

Endoplasmic reticulum0.084

Rank 5 · LXL04_013493 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5X8`	Arabidopsis thaliana	Molybdenum cofactor sulfurase	25.806%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card