TkA02G483930 | RubberDandelionOmics

Gene overview

TkA02G483930

Reference: TK1151 Chr: Chr02 Coordinates: 123557038-123559564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1772 bp · TkA02G483930|TK1151|cDNA

ATCTCTTCTCCTTCAATATCCCTTTCCTTACACGAGCCTAGGAATCCAACCACCAATCCGCCCGTTATTGCACGTTAACTAGGGCGATTGGTGGTGGATCACGGCGGGAGTGGTGATCCCGGAGATATTGATATTGGCTTTTGTTCGTGTGCGCATAGCCAAAATACATTCATAGATATATTCGGCTGTTGACGTGGGTCTAGGCTTAAACGGCCGATTGATCTACGCGACGGAAGTGATCTTCAAATAAATATCAACAT...

CDS

Download CDS FASTA

1146 bp · TkA02G483930|TK1151|CDS

ATGAATAATAGCAACGAGGAAGTTCCCCAAATTGCCAGGAAAATCGAACCGGTGCCTCCTCCATTACCTGTTTCGTCAACAACATCCATTAATCATCCGAAGGGATGCACGCCGAGCAAAATCCGGTCATCATGGATGCAAAGAGATAGTTGCGTATCTTCACCTGCAAAGGAATCATGGAACCGTCTCTTTGACGAAGCTTACAGAGCTGATGTTAAGATCTATACAGATAATGACACAATAATCACTGCACATGCTAA...

Protein

Download Protein FASTA

381 aa · TkA02G483930|TK1151|PROTEIN

MNNSNEEVPQIARKIEPVPPPLPVSSTTSINHPKGCTPSKIRSSWMQRDSCVSSPAKESWNRLFDEAYRADVKIYTDNDTIITAHANILGFTSPVFRGMIKKSKSRHRISIRGVPPEAVGTFIRYLYTSCYEVSQMEKHVLSLVVLSHAFAVPQLKRECEDHIEHGFLDLENVIDVFQLSMLCDAPRLSILCHRFVLKNFKPVSSSPAWKAMRSSHPKLEKKLLECIRSEDRRRKQRVRKMKENKVYVQLYDAMEALVHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G483930`
TK1151 ID	TkA02G483930
OH-1004 ID	LXL04_006712
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.900
Protein coverage (%)	TK1151 99.738 / OH-1004 98.942 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G483930

Location Chr02:123557038-123559564 (+)

Description Similar to BT4: BTB/POZ and TAZ domain-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67480`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g37610`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g05690`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g16710`	Acetyltransferase enzyme.	No verified direct reference in this release
`At1g79000`	Acetyltransferase enzyme.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G05690

ath:AT3G48360

ath:AT4G37610

ath:AT5G63160

ath:AT5G67480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.474

Rank 1 · TkA02G483930 · TK1151

Nucleus0.458

Rank 2 · TkA02G483930 · TK1151

Cell membrane0.082

Rank 3 · TkA02G483930 · TK1151

Mitochondrion0.038

Rank 4 · TkA02G483930 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA02G483930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02135zf-TAZ32-37 aa

PF00651BTB61-165 aa

PF02135zf-TAZ129-141 aa

PF07707BACK141-180 aa

PF00651BTB170-198 aa

PF07707BACK174-214 aa

PF02135zf-TAZ252-336 aa

PF25080zf_RING-like308-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G483930	`PF02135`	zf-TAZ	32	37	1.6e-10	41.9
TkA02G483930	`PF00651`	BTB	61	165	6.7e-14	52.7
TkA02G483930	`PF02135`	zf-TAZ	129	141	1.6e-10	41.9
TkA02G483930	`PF07707`	BACK	141	180	0.078	13.8
TkA02G483930	`PF00651`	BTB	170	198	6.7e-14	52.7
TkA02G483930	`PF07707`	BACK	174	214	0.078	13.8
TkA02G483930	`PF02135`	zf-TAZ	252	336	1.6e-10	41.9
TkA02G483930	`PF25080`	zf_RING-like	308	340	0.028	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJX5`	Arabidopsis thaliana	sp\|Q9FJX5\|BT4_ARATH BTB/POZ and TAZ domain-containing protein 4	52.900%	Swiss-Prot	High
`Q6EJ98`	Arabidopsis thaliana	sp\|Q6EJ98\|BT5_ARATH BTB/POZ and TAZ domain-containing protein 5	52.900%	Swiss-Prot	High
`Q9SYL0`	Arabidopsis thaliana	sp\|Q9SYL0\|BT3_ARATH BTB/POZ and TAZ domain-containing protein 3	46.000%	Swiss-Prot	Medium
`Q9FWQ5`	Arabidopsis thaliana	sp\|Q9FWQ5\|HAC12_ARATH Histone acetyltransferase HAC12	49.100%	Swiss-Prot	Low
`Q9C5X9`	Arabidopsis thaliana	sp\|Q9C5X9\|HAC1_ARATH Histone acetyltransferase HAC1	48.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card