TkA02G483400 | RubberDandelionOmics

Gene overview

TkA02G483400

Reference: TK1151 Chr: Chr02 Coordinates: 123367340-123370233 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2248 bp · TkA02G483400|TK1151|cDNA

TACACCAAAAGCACAAAAAAGAATATCACTTCGCCACCGCTGGCGTCCCGTGGGGGTCCTACACCAAAAGCACAAAAAAGAATATCACTTCGCCACCGCTCATTCACACCCCTTCCACCAACCCCCCTACCATCCTCTCGTTACCTCCACGGCTGAGAATCAGCCTAGTATGGCTGTTTCATCTTCCAGTTCTTGCATCTCCCTCCAAAGATTGCGCCGTCAAACGGCTACTTCGGACCTTTTTACGCCGCCGGCAAGTG...

CDS

Download CDS FASTA

1002 bp · TkA02G483400|TK1151|CDS

ATGCTATATACTGAAATGGATTTACTAATTACTAATAGCACATACGAAGTAGCAACAGCCTGTGCTTTAGCTCTCGGAGCAGAGAAGCTGATCTGCATCATCGACGGTCCAATTCTGGATGAATGGGGACGTTTGATCAGGTTCCTGACTCTCGAAGATGCAGACATGCTAATACGCAGACGTGCAAAGCAAAGCGAAGTTGCTGCTAATTACGTAAAAGCCATTGATGAAGAAGATCCGGTTTCAAGCTCCCATGGATT...

Protein

Download Protein FASTA

333 aa · TkA02G483400|TK1151|PROTEIN

MLYTEMDLLITNSTYEVATACALALGAEKLICIIDGPILDEWGRLIRFLTLEDADMLIRRRAKQSEVAANYVKAIDEEDPVSSSHGFTATFQNGVGFDNGNGLWSSEQGFAIGGQERLSRSNGYLSELAAAAFVCRGGVQRVHLLDGSTSGVLLKELFQRDGVGTMVASDLYEGTRMAKVDDLPGIRLIFKPLEDSGTLVKRTDEELLKALDSFVVVEREGQIIACSALFPFYKEKCGEVAAIAVSPDCRGQGQGDKLLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G483400`
TK1151 ID	TkA02G483400
OH-1004 ID	LXL04_013628
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 99.399 / OH-1004 52.540 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G483400

Location Chr02:123367340-123370233 (+)

Description Similar to NAGS2: Probable amino-acid acetyltransferase NAGS2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37670`	N-acetylglutamate synthase involved in arginine biosynthesis.	No verified direct reference in this release
`At2g22910`	N-acetylglutamate synthase involved in arginine biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013628 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004042 L-glutamate N-acetyltransferase activity Molecular Function

GO:0004358 L-glutamate N-acetyltransferase activity, acting on acetyl-L-ornithine as donor Molecular Function

KEGG gene cross-reference

ath:AT2G22910

ath:AT4G37670

avn:Avin_04920

pmy:Pmen_0354

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.477

Rank 1 · TkA02G483400 · TK1151

Nucleus0.326

Rank 2 · TkA02G483400 · TK1151

Plastid0.108

Rank 3 · TkA02G483400 · TK1151

Mitochondrion0.092

Rank 4 · TkA02G483400 · TK1151

Peroxisome0.066

Rank 5 · TkA02G483400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08445FR47141-174 aa

PF00583Acetyltransf_1151-168 aa

PF13508Acetyltransf_7152-167 aa

PF13527Acetyltransf_9206-270 aa

PF00583Acetyltransf_1208-279 aa

PF13508Acetyltransf_7213-291 aa

PF13673Acetyltransf_10213-294 aa

PF23209IDM1_C215-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G483400	`PF08445`	FR47	141	174	0.0046	17.6
TkA02G483400	`PF00583`	Acetyltransf_1	151	168	5.3e-14	53.2
TkA02G483400	`PF13508`	Acetyltransf_7	152	167	1.8e-12	48.2
TkA02G483400	`PF13527`	Acetyltransf_9	206	270	0.0033	18.1
TkA02G483400	`PF00583`	Acetyltransf_1	208	279	5.3e-14	53.2
TkA02G483400	`PF13508`	Acetyltransf_7	213	291	1.8e-12	48.2
TkA02G483400	`PF13673`	Acetyltransf_10	213	294	7.7e-05	23.4
TkA02G483400	`PF23209`	IDM1_C	215	300	2.6e-06	28.3
TkA02G483400	`PF08445`	FR47	235	270	0.0046	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B5X4Z4`	Arabidopsis thaliana	sp\|B5X4Z4\|NAGS2_ARATH Probable amino-acid acetyltransferase NAGS2, chloroplastic	73.300%	Swiss-Prot	High
`Q84JF4`	Arabidopsis thaliana	sp\|Q84JF4\|NAGS1_ARATH Probable amino-acid acetyltransferase NAGS1, chloroplastic	72.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card