Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1482 bp · TkA02G476820|TK1151|cDNA
TTTTGAATCATTCATCGAGATAATGAGATTGCGTTTCCGTTTTAGACTTTAGATTGCCAGATTGGTAACTTTAAAGATTGGATATTAATCAAATATGCATCGAGAATTGGAAATTTCACCAGGGGGTTTCACTTGATTCACGGTAACCATAACAACGAACCCCAACATCATCATCTACCGACTCCAATTCTTTAACCGACCCATTTGAATTCTTCATTTACGTTAGATTTTAGGGTTAGGGTCTTAGTTCCCTCGCCGAA...
1026 bp · TkA02G476820|TK1151|CDS
ATGATGAAGGGCGTAGAATTAACACCTGAATTGCAAGAGATTCTTAATGCCAACATGGATTGCGTGCAAGAGAGGCGCACCGCTCGTGAGGCCTTCAAGGATATTCAGCTCAACATCGATCATATCTTGTTCAACACAAAATATGAGGGATTGAAGACAAAAGAGACATATGAGACTAACTCTAAAGGGGTAGAAATTTTCTCAAAAAGTTGGCTTCCGGGAGCAAAGCCTCCAAAAGCAGTAGTTTGCTATTGCCATGG...
Protein
Download Protein FASTA341 aa · TkA02G476820|TK1151|PROTEIN
MMKGVELTPELQEILNANMDCVQERRTAREAFKDIQLNIDHILFNTKYEGLKTKETYETNSKGVEIFSKSWLPGAKPPKAVVCYCHGYGDTCTFFFEGIARKFASCGYAVFAMDLPGLGLSEGLHCYIPSFDALVDDVIEHYSKVVENPEIRDLPRFLLGQSMGGAVALKVHLKQPTYWSGAVLVAPMCKIADDVVPPWAVTQFLIGMSKVMPKMKLVPQKDLADMAFRDPKKKHLTSYSVIGYKDKPRLGTAMELLKTS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G476820 |
|---|---|
| TK1151 ID | TkA02G476820 |
| OH-1004 ID | LXL04_013710 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G476820 |
|---|---|
| Location | Chr02:121706893-121710295 (+) |
| Description | Similar to CSE: Caffeoylshikimate esterase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0009966 regulation of signal transduction Biological Process GO:0010043 response to zinc ion Biological Process GO:0016042 lipid catabolic process Biological Process GO:0019369 arachidonate metabolic process Biological Process GO:0019433 triglyceride catabolic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0045471 response to ethanol Biological Process GO:0045907 positive regulation of vasoconstriction Biological Process |
| KEGG gene cross-reference | ath:AT1G52760 hsa:11343 mmu:23945 msg:MSMEI_0213 msm:MSMEG_0220 rno:29254 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12146Hydrolase_49-60 aaPF05448AXE136-119 aaPF02129Peptidase_S1543-301 aaPF02230Abhydrolase_274-96 aaPF12146Hydrolase_477-319 aaPF01738DLH77-115 aaPF20408Abhydrolase_1179-174 aaPF00561Abhydrolase_181-316 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G476820 | PF12146 | Hydrolase_4 | 9 | 60 | 3.5e-64 | 217.1 |
| TkA02G476820 | PF05448 | AXE1 | 36 | 119 | 2.1e-05 | 24.2 |
| TkA02G476820 | PF02129 | Peptidase_S15 | 43 | 301 | 0.024 | 15.0 |
| TkA02G476820 | PF02230 | Abhydrolase_2 | 74 | 96 | 3.5e-06 | 27.7 |
| TkA02G476820 | PF12146 | Hydrolase_4 | 77 | 319 | 3.5e-64 | 217.1 |
| TkA02G476820 | PF01738 | DLH | 77 | 115 | 0.0043 | 17.4 |
| TkA02G476820 | PF20408 | Abhydrolase_11 | 79 | 174 | 0.00016 | 22.2 |
| TkA02G476820 | PF00561 | Abhydrolase_1 | 81 | 316 | 6.6e-14 | 52.9 |
| TkA02G476820 | PF12697 | Abhydrolase_6 | 85 | 322 | 4.6e-12 | 47.7 |
| TkA02G476820 | PF00326 | Peptidase_S9 | 104 | 190 | 6.8e-05 | 23.2 |
| TkA02G476820 | PF07859 | Abhydrolase_3 | 131 | 191 | 0.058 | 13.8 |
| TkA02G476820 | PF05448 | AXE1 | 145 | 171 | 2.1e-05 | 24.2 |
| TkA02G476820 | PF00756 | Esterase | 153 | 247 | 4.6e-05 | 24.0 |
| TkA02G476820 | PF02230 | Abhydrolase_2 | 157 | 186 | 3.5e-06 | 27.7 |
| TkA02G476820 | PF01738 | DLH | 158 | 175 | 0.0043 | 17.4 |
| TkA02G476820 | PF00326 | Peptidase_S9 | 237 | 337 | 6.8e-05 | 23.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.