TkA02G476670 | RubberDandelionOmics

Gene overview

TkA02G476670

Reference: TK1151 Chr: Chr02 Coordinates: 121647581-121648564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · TkA02G476670|TK1151|cDNA

ATGTCAACCAAATCTCGACTCCAAAACCACACCCCCATGGTTGAGGAGATCACCGGTTTGATCCGGGTTCACAAAGACGGCTATGTTGAAAGACCACCGGTTGTACCTCATGCTTCTTGCATGGTACCATCGGAGCTCAGGGTTGTAGCCACCGATGTCACCATAGATAAATATACTAACTTATGGGCACGTGTCTATACCCCTAGCAACCGACACTATTTTTCATCAAAAGTATTGCCGGTGGTAGTTTACTTTCATGG...

CDS

Download CDS FASTA

984 bp · TkA02G476670|TK1151|CDS

ATGTCAACCAAATCTCGACTCCAAAACCACACCCCCATGGTTGAGGAGATCACCGGTTTGATCCGGGTTCACAAAGACGGCTATGTTGAAAGACCACCGGTTGTACCTCATGCTTCTTGCATGGTACCATCGGAGCTCAGGGTTGTAGCCACCGATGTCACCATAGATAAATATACTAACTTATGGGCACGTGTCTATACCCCTAGCAACCGACACTATTTTTCATCAAAAGTATTGCCGGTGGTAGTTTACTTTCATGG...

Protein

Download Protein FASTA

327 aa · TkA02G476670|TK1151|PROTEIN

MSTKSRLQNHTPMVEEITGLIRVHKDGYVERPPVVPHASCMVPSELRVVATDVTIDKYTNLWARVYTPSNRHYFSSKVLPVVVYFHGGGFCVGSASWVCYHDFLANLARVACCVIVSVNYRLAPENRLPAAYDDGVNAVFWLKQECLNGTVKELKWCDLSRLYIAGDSAGANIAHHVAKRLVSNPVLSPKGVVLIQPFFGAESRTVSEKQSVQTTSSGLTLSASDTYWRLALPVGATRDHPWCNLFAKDAPRLSDSRLFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G476670`
TK1151 ID	TkA02G476670
OH-1004 ID	LXL04_013713
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 97.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G476670

Location Chr02:121647581-121648564 (+)

Description Similar to CXE17: Probable carboxylesterase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16080`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g68620`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At5g06570`	May bind strigolactones and catalyze their hydrolysis.	Catabolism of strigolactones by a carboxylesterase.2021 · DOI: 10.1038/s41477-021-01011-y Structural insights into strigolactone catabolism by carboxylesterases reveal a conserved conformational regulation.2024 · DOI: 10.1038/s41467-024-50928-3
`At5g27320`	Functions as a soluble gibberellin (GA) receptor.	Identification and characterization of Arabidopsis gibberellin receptors.2006 · DOI: 10.1111/j.1365-313x.2006.02748.x Genetic characterization and functional analysis of the GID1 gibberellin receptors in Arabidopsis.2006 · DOI: 10.1105/tpc.106.047415 Multiple loss-of-function of Arabidopsis gibberellin receptor AtGID1s completely shuts down a gibberellin signal.2007 · DOI: 10.1111/j.1365-313x.2007.03098.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013713 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048444 floral organ morphogenesis Biological Process

GO:0048530 fruit morphogenesis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010331 gibberellin binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G68620

ath:AT5G16080

ath:AT5G23530

ath:AT5G27320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.744

Rank 1 · TkA02G476670 · TK1151

Nucleus0.369

Rank 2 · TkA02G476670 · TK1151

Cell membrane0.051

Rank 3 · TkA02G476670 · TK1151

Peroxisome0.050

Rank 4 · TkA02G476670 · TK1151

Mitochondrion0.050

Rank 5 · TkA02G476670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10340Say1_Mug18062-215 aa

PF00135COesterase63-123 aa

PF20434BD-FAE76-176 aa

PF07224Chlorophyllase79-207 aa

PF07859Abhydrolase_382-302 aa

PF00326Peptidase_S9152-175 aa

PF00135COesterase161-176 aa

PF00975Thioesterase162-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G476670	`PF10340`	Say1_Mug180	62	215	5.8e-07	29.4
TkA02G476670	`PF00135`	COesterase	63	123	1.6e-10	41.3
TkA02G476670	`PF20434`	BD-FAE	76	176	8.5e-11	42.5
TkA02G476670	`PF07224`	Chlorophyllase	79	207	0.0015	18.2
TkA02G476670	`PF07859`	Abhydrolase_3	82	302	7.7e-60	203.0
TkA02G476670	`PF00326`	Peptidase_S9	152	175	0.12	12.6
TkA02G476670	`PF00135`	COesterase	161	176	1.6e-10	41.3
TkA02G476670	`PF00975`	Thioesterase	162	196	0.18	12.7
TkA02G476670	`PF01738`	DLH	189	207	0.14	12.5
TkA02G476670	`PF18059`	Csd3_N	255	303	0.34	12.1
TkA02G476670	`PF01738`	DLH	272	307	0.14	12.5
TkA02G476670	`PF00326`	Peptidase_S9	274	307	0.12	12.6
TkA02G476670	`PF00975`	Thioesterase	277	302	0.18	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFR7`	Arabidopsis thaliana	sp\|Q9LFR7\|CXE17_ARATH Probable carboxylesterase 17	54.600%	Swiss-Prot	High
`Q9SX25`	Arabidopsis thaliana	sp\|Q9SX25\|CXE6_ARATH Probable carboxylesterase 6	48.300%	Swiss-Prot	Medium
`Q9FG13`	Arabidopsis thaliana	sp\|Q9FG13\|CXE15_ARATH Strigolactones hydrolase CXE15	37.200%	Swiss-Prot	Medium
`Q940G6`	Arabidopsis thaliana	sp\|Q940G6\|GID1C_ARATH Gibberellin receptor GID1C	35.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card