TkA02G471650 | RubberDandelionOmics

Gene overview

TkA02G471650

Reference: TK1151 Chr: Chr02 Coordinates: 120335745-120336735 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

839 bp · TkA02G471650|TK1151|cDNA

CAACGTTATCTAAATATGCTACTTCTTCAAAAACCACAGGGACCACTATTAAACTTTTGTCTATATAAATCTTGGAGGTCGACTGGTTGTTAGAATATAATAAATCTTGAAGGTCGACGAATATAATAAATCTTGAAGGTCGACTGATGGACCCCCCCTATGCATCGTTAATCCTCCAGCAGAAGAAATGGCACATTATGGACGACAGCAGGGTCAACACACCAACGAGGGAGTGGAAGGTTATGAGAAGAAAGGAATAA...

CDS

Download CDS FASTA

354 bp · TkA02G471650|TK1151|CDS

ATGGCACATTATGGACGACAGCAGGGTCAACACACCAACGAGGGAGTGGAAGGTTATGAGAAGAAAGGAATAATGGAGAAAATAAAGGAGCAGCTACCTGGTGGCGGTGGGCAGAAGGCTTCGACCACGGCCACCGTTGGTGGTGGTACAAGTGCATATACGGGAGTTGGAGGGCATGAGAAAAAGGGAATGGTGGAGAAAATAAAGGAGAAGCTACCGGGTGGTGGTAAGCACAAGGCTTCAACCACAGGTAACGTGGG...

Protein

Download Protein FASTA

117 aa · TkA02G471650|TK1151|PROTEIN

MAHYGRQQGQHTNEGVEGYEKKGIMEKIKEQLPGGGGQKASTTATVGGGTSAYTGVGGHEKKGMVEKIKEKLPGGGKHKASTTGNVGGGTGAYAGVGGHEKKGMLEKIKEKLPGSHQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G471650`
TK1151 ID	TkA02G471650
OH-1004 ID	LXL04_013786
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 46.154 / OH-1004 46.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G471650`
Location	Chr02:120335745-120336735 (-)
Description	Similar to COR47: Dehydrin COR47
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013786` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006970 response to osmotic stress Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010286 heat acclimation Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0005507 copper ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G20440 ath:AT3G50970 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.631

Rank 1 · TkA02G471650 · TK1151

Nucleus0.279

Rank 2 · TkA02G471650 · TK1151

Cell membrane0.226

Rank 3 · TkA02G471650 · TK1151

Mitochondrion0.057

Rank 4 · TkA02G471650 · TK1151

Extracellular0.050

Rank 5 · TkA02G471650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257Dehydrin14-75 aa

PF22858DUF701615-30 aa

PF23403LTI65_LTI78_N20-31 aa

PF22858DUF701652-70 aa

PF00257Dehydrin54-116 aa

PF23403LTI65_LTI78_N59-71 aa

PF22858DUF701692-110 aa

PF23403LTI65_LTI78_N99-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G471650	`PF00257`	Dehydrin	14	75	2e-28	100.5
TkA02G471650	`PF22858`	DUF7016	15	30	2.6	8.9
TkA02G471650	`PF23403`	LTI65_LTI78_N	20	31	0.77	10.9
TkA02G471650	`PF22858`	DUF7016	52	70	2.6	8.9
TkA02G471650	`PF00257`	Dehydrin	54	116	2e-28	100.5
TkA02G471650	`PF23403`	LTI65_LTI78_N	59	71	0.77	10.9
TkA02G471650	`PF22858`	DUF7016	92	110	2.6	8.9
TkA02G471650	`PF23403`	LTI65_LTI78_N	99	111	0.77	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card