LXL04_013786 | RubberDandelionOmics

Gene overview

LXL04_013786

Reference: OH-1004 Chr: Chr03 Coordinates: 36041479-36041832 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · LXL04_013786|LXL04_013786|OH1004|cDNA

ATGGCACATTATGGACGACAGCAGGGTCAACACACCAACGAGGGAGTGGAAGGTTATGAGAAGAAAGGAATAATGGAGAAAATAAAGGAGCAGCTACCTGGTGGCGGTGGGCAGAAGGCTTCGACCACGGCCACCGTTGGTGGTGGCACAGGTGCATATACGGGAGTTGGAGGGCATGAGAAAAAGGGAATGATGGAGAAAATAAAGGAGAAGCTACCGGGTGGTGGTAAGCACAAGGCTTCAACCACAGGTAACGTGGG...

CDS

Download CDS FASTA

354 bp · LXL04_013786|LXL04_013786|OH1004|CDS

ATGGCACATTATGGACGACAGCAGGGTCAACACACCAACGAGGGAGTGGAAGGTTATGAGAAGAAAGGAATAATGGAGAAAATAAAGGAGCAGCTACCTGGTGGCGGTGGGCAGAAGGCTTCGACCACGGCCACCGTTGGTGGTGGCACAGGTGCATATACGGGAGTTGGAGGGCATGAGAAAAAGGGAATGATGGAGAAAATAAAGGAGAAGCTACCGGGTGGTGGTAAGCACAAGGCTTCAACCACAGGTAACGTGGG...

Protein

Download Protein FASTA

117 aa · LXL04_013786|LXL04_013786|OH1004|PROTEIN

MAHYGRQQGQHTNEGVEGYEKKGIMEKIKEQLPGGGGQKASTTATVGGGTGAYTGVGGHEKKGMMEKIKEKLPGGGKHKASTTGNVGGGTGAYAGVGGHEKKGMVEKIKEKLPGSHQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013786`
TK1151 ID	TkA02G471650
OH-1004 ID	LXL04_013786
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 46.154 / OH-1004 46.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013786

Location Chr03:36041479-36041832 (+)

Description Similar to COR47: Dehydrin COR47

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20440`	Dehydrin COR47.	No verified direct reference in this release
`At3g50970`	Dehydrin Xero 2.	No verified direct reference in this release
`At3g50980`	Dehydrin Xero 1.	No verified direct reference in this release
`At1g20450`	Dehydrin ERD10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013786 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010286 heat acclimation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G20440

ath:AT3G50970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.635

Rank 1 · LXL04_013786 · OH-1004

Nucleus0.277

Rank 2 · LXL04_013786 · OH-1004

Cell membrane0.229

Rank 3 · LXL04_013786 · OH-1004

Mitochondrion0.058

Rank 4 · LXL04_013786 · OH-1004

Extracellular0.054

Rank 5 · LXL04_013786 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257.25Dehydrin14-75 aa

PF00257.25Dehydrin55-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013786	`PF00257.25`	Dehydrin	14	75	9.8e-29	101.5
LXL04_013786	`PF00257.25`	Dehydrin	55	116	9.8e-29	101.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P31168`	Arabidopsis thaliana	Dehydrin COR47	40.000%	Swiss-Prot	moderate database homology
`P42758`	Arabidopsis thaliana	Dehydrin Xero 2	45.455%	Swiss-Prot	moderate database homology
`P25863`	Arabidopsis thaliana	Dehydrin Xero 1	64.286%	Swiss-Prot	weak database homology
`P42759`	Arabidopsis thaliana	Dehydrin ERD10	41.818%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card