TkA02G470110 | RubberDandelionOmics

Gene overview

TkA02G470110

Reference: TK1151 Chr: Chr02 Coordinates: 119958982-119961370 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1602 bp · TkA02G470110|TK1151|cDNA

ATGGAAGCTAAAACCAAATCCAGACCTGCAGATTCTAGCGAGTGGCATTTGTGGCTGTTAGTGGCGGCCATCGCGGTTCTCCTCGCCGGAGCTGTGTCCATCACTATATGGAGAAACTCCCATCAGCTTAAAAACAGGGTTCCTCATGTTCGTAGGCCTCCCCACGGCGTTATGCAGAAATATAGAGATGCTCTTCGCATTTCGACGCAATTCTTCGATGTTCAAAGATCTGGGAGATTAGTGAACAATCAGATTGAATG...

CDS

Download CDS FASTA

1602 bp · TkA02G470110|TK1151|CDS

ATGGAAGCTAAAACCAAATCCAGACCTGCAGATTCTAGCGAGTGGCATTTGTGGCTGTTAGTGGCGGCCATCGCGGTTCTCCTCGCCGGAGCTGTGTCCATCACTATATGGAGAAACTCCCATCAGCTTAAAAACAGGGTTCCTCATGTTCGTAGGCCTCCCCACGGCGTTATGCAGAAATATAGAGATGCTCTTCGCATTTCGACGCAATTCTTCGATGTTCAAAGATCTGGGAGATTAGTGAACAATCAGATTGAATG...

Protein

Download Protein FASTA

533 aa · TkA02G470110|TK1151|PROTEIN

MEAKTKSRPADSSEWHLWLLVAAIAVLLAGAVSITIWRNSHQLKNRVPHVRRPPHGVMQKYRDALRISTQFFDVQRSGRLVNNQIEWRGDSGLQDGKEEDLDLSKGLYDAGDLIKFGFPMAFTATVLAWSILEYSQHMEAANELKHAQESLKWITDYLINAHPSDNVLYIQVGDPDVDHKCWERPEKSTEKRPAIQVNMSHPGSDVAAETAAAMAAASLVFKNHNARYSKSLLEHAQKLFQFADGYRGVYSESIPRVQDY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G470110`
TK1151 ID	TkA02G470110
OH-1004 ID	LXL04_035730
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.700
Protein coverage (%)	TK1151 96.811 / OH-1004 86.172 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G470110

Location Chr02:119958982-119961370 (+)

Description Similar to Os09g0533900: Endoglucanase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75680`	Endoglucanase 10.	No verified direct reference in this release
`At1g19940`	Endoglucanase 2.	No verified direct reference in this release
`At2g44560`	Endoglucanase 14.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0533900`	Endoglucanase 24.	No verified direct reference in this release
`Os06g0715300`	Endoglucanase 18.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035730 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0008810 cellulase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G19940

ath:AT1G75680

ath:AT4G11050

dosa:Os06g0715300

dosa:Os09g0533900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.712

Rank 1 · TkA02G470110 · TK1151

Cytoplasm0.123

Rank 2 · TkA02G470110 · TK1151

Lysosome / Vacuole0.098

Rank 3 · TkA02G470110 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA02G470110 · TK1151

Extracellular0.077

Rank 5 · TkA02G470110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10814CwsA15-43 aa

PF00759Glyco_hydro_961-519 aa

PF10814CwsA138-150 aa

PF10814CwsA212-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G470110	`PF10814`	CwsA	15	43	0.4	11.7
TkA02G470110	`PF00759`	Glyco_hydro_9	61	519	5.6e-154	514.3
TkA02G470110	`PF10814`	CwsA	138	150	0.4	11.7
TkA02G470110	`PF10814`	CwsA	212	224	0.4	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LCP6`	Arabidopsis thaliana	sp\|Q8LCP6\|GUN10_ARATH Endoglucanase 10	57.400%	Swiss-Prot	High
`Q9FXI9`	Arabidopsis thaliana	sp\|Q9FXI9\|GUN2_ARATH Endoglucanase 2	60.600%	Swiss-Prot	High
`Q8S8Q4`	Arabidopsis thaliana	sp\|Q8S8Q4\|GUN14_ARATH Endoglucanase 14	45.800%	Swiss-Prot	Medium
`Q69SG5`	Oryza sativa subsp. japonica	sp\|Q69SG5\|GUN24_ORYSJ Endoglucanase 24	61.100%	Swiss-Prot	High
`Q5Z9P8`	Oryza sativa subsp. japonica	sp\|Q5Z9P8\|GUN18_ORYSJ Endoglucanase 18	55.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card