LXL04_035730 | RubberDandelionOmics

Gene overview

LXL04_035730

Reference: OH-1004 Chr: Chr08 Coordinates: 27765615-27767997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1782 bp · LXL04_035730|LXL04_035730|OH1004|cDNA

ATGGTGGCGAAAGCAATGGGGCAACCTAGATTGATTGTTTCAACTGCCATGTGTCTCCACTCTCCAATGGCGTCGAGACTACCGCTCCCACAGTTGGTTCAACTACATTGGCCTCAATTCCCCTTCGATCTCCAGATCCATATATTATCATCAGTCAGTTCCTTCAGATCTGGAGGGTTATTCCAAAATCACTTTGAGAAGTTGGGGGAAATGGGGAAGGAGAAGAAATCTGGTGGATGTTTGGGGTGGTTCATTGTGTT...

CDS

Download CDS FASTA

1782 bp · LXL04_035730|LXL04_035730|OH1004|CDS

ATGGTGGCGAAAGCAATGGGGCAACCTAGATTGATTGTTTCAACTGCCATGTGTCTCCACTCTCCAATGGCGTCGAGACTACCGCTCCCACAGTTGGTTCAACTACATTGGCCTCAATTCCCCTTCGATCTCCAGATCCATATATTATCATCAGTCAGTTCCTTCAGATCTGGAGGGTTATTCCAAAATCACTTTGAGAAGTTGGGGGAAATGGGGAAGGAGAAGAAATCTGGTGGATGTTTGGGGTGGTTCATTGTGTT...

Protein

Download Protein FASTA

593 aa · LXL04_035730|LXL04_035730|OH1004|PROTEIN

MVAKAMGQPRLIVSTAMCLHSPMASRLPLPQLVQLHWPQFPFDLQIHILSSVSSFRSGGLFQNHFEKLGEMGKEKKSGGCLGWFIVLIVVAAIAIALGFTLRNKFHGGGGDAPVPGPPGAITKKYGDALKVALQFFDIQKAGKLEDNDIPWRGDSALDDGEDAKLDLSKGMYDAGDHMKFQFPMAYTATVLSWAILEYGDQMNAAGQLQSAKNSLKWLTDYFINAHPEPNVLYIQVGDPDLDHKCWDRPEDMTEKRPLTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035730`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035730

Location Chr08:27765615-27767997 (-)

Description Similar to Os09g0533900: Endoglucanase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19940`	Endoglucanase 2.	No verified direct reference in this release
`At1g75680`	Endoglucanase 10.	No verified direct reference in this release
`At4g11050`	Endoglucanase 19.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0533900`	Endoglucanase 24.	No verified direct reference in this release
`Os06g0715300`	Endoglucanase 18.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035730 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0008810 cellulase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G19940

ath:AT1G75680

ath:AT4G11050

dosa:Os06g0715300

dosa:Os09g0533900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.660

Rank 1 · LXL04_035730 · OH-1004

Extracellular0.146

Rank 2 · LXL04_035730 · OH-1004

Cytoplasm0.124

Rank 3 · LXL04_035730 · OH-1004

Lysosome / Vacuole0.110

Rank 4 · LXL04_035730 · OH-1004

Endoplasmic reticulum0.089

Rank 5 · LXL04_035730 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_9125-579 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035730	`PF00759.26`	Glyco_hydro_9	125	579	3.7e-156	521.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXI9`	Arabidopsis thaliana	Endoglucanase 2	71.242%	Swiss-Prot	strong database homology
`Q8LCP6`	Arabidopsis thaliana	Endoglucanase 10	66.476%	Swiss-Prot	strong database homology
`Q8L7I0`	Arabidopsis thaliana	Endoglucanase 19	46.921%	Swiss-Prot	moderate database homology
`Q69SG5`	Oryza sativa subsp. japonica	Endoglucanase 24	67.490%	Swiss-Prot	strong database homology
`Q5Z9P8`	Oryza sativa subsp. japonica	Endoglucanase 18	63.895%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card