TkA02G469810 | RubberDandelionOmics

Gene overview

TkA02G469810

Reference: TK1151 Chr: Chr02 Coordinates: 119853172-119856326 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

848 bp · TkA02G469810|TK1151|cDNA

TTTATGCACGTGGTGGATGATGAAGGGAAGCTTGAAGGGTTGATAACGCTGACAGAGATTATATCGAGATTGATGGAAATGTTGCCCGAGAGATCATAAATCACAGATCGCTTCGTCACCCGAATATAATTCGGTTTAGAGAGGTGGTGCTGACTCCCACCCATCTTGCTATTGTGATGGAGTATGCTGCAGGAGGGGAGCTTTTTGACAGGATTTGTAATGCTGGAAGATTCAGTGAAGATGAGAAAACCCTCGTCAAA...

CDS

Download CDS FASTA

549 bp · TkA02G469810|TK1151|CDS

ATGGGTGCCTGTTTGTCAACCACTAAGATCAGTGGCTCCAACAGCACCACCGCCGATCGCCGCCGGACAGAAACTGCCACCGGCAAGCATAATGTCAAATCCGATACACCCACAGAGATCCACAGGAATCAACACCAAAAACACAAGACCCAACAGCAGAACAATAACAAAAACAAGAGGAAAGAAAGGTCGTCTTCAAAAAATGGAGTGATTCCATGTGGGAAAACAACCGATTTTGGGTACCTTAAGGATTTTGATAG...

Protein

Download Protein FASTA

182 aa · TkA02G469810|TK1151|PROTEIN

MGACLSTTKISGSNSTTADRRRTETATGKHNVKSDTPTEIHRNQHQKHKTQQQNNNKNKRKERSSSKNGVIPCGKTTDFGYLKDFDSTYSIGKLLGHGQFGYTYVAIDKANGDRVAVKKIDKNKMILPIAVEDVKREVKILQALSGHENVVQFHNAYEDSSYVYIVMELCEGGELLDRILGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G469810`
TK1151 ID	TkA02G469810
OH-1004 ID	LXL04_013822
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 32.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G469810

Location Chr02:119853172-119856326 (-)

Description Similar to CPK28: Calcium-dependent protein kinase 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66210`	May play a role in signal transduction pathways that involve calcium as a second messenger (Probable).	Function of calcium-dependent protein kinase CPK28 of Arabidopsis thaliana in plant stem elongation and vascular development.2013 · DOI: 10.1111/tpj.12090 The calcium-dependent protein kinase CPK28 buffers plant immunity and regulates BIK1 turnover.2014 · DOI: 10.1016/j.chom.2014.10.007 Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486
`At2g17890`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At4g36070`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0409900`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	A rice calcium-dependent protein kinase is expressed in cortical root cells during the presymbiotic phase of the arbuscular mycorrhizal symbiosis.2011 · DOI: 10.1186/1471-2229-11-90 Rice small C2-domain proteins are phosphorylated by calcium-dependent protein kinase.2013 · DOI: 10.1007/s10059-013-2185-0 Direct phosphorylation and activation of a mitogen-activated protein kinase by a calcium-dependent protein kinase in rice.2014 · DOI: 10.1105/tpc.114.126441
`Os02g0126400`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013822 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051592 response to calcium ion Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17890

ath:AT4G36070

ath:AT5G66210

dosa:Os02g0126400

dosa:Os07g0409900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA02G469810 · TK1151

Cell membrane0.388

Rank 2 · TkA02G469810 · TK1151

Nucleus0.270

Rank 3 · TkA02G469810 · TK1151

Golgi apparatus0.060

Rank 4 · TkA02G469810 · TK1151

Lysosome / Vacuole0.054

Rank 5 · TkA02G469810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28979DUF849023-94 aa

PF01080Presenilin24-62 aa

PF03612EIIBC-GUT_N41-60 aa

PF00069Pkinase42-55 aa

PF00069Pkinase89-179 aa

PF07714PK_Tyr_Ser-Thr91-178 aa

PF03612EIIBC-GUT_N112-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G469810	`PF28979`	DUF8490	23	94	0.021	14.6
TkA02G469810	`PF01080`	Presenilin	24	62	0.71	9.3
TkA02G469810	`PF03612`	EIIBC-GUT_N	41	60	0.47	10.9
TkA02G469810	`PF00069`	Pkinase	42	55	5.4e-19	69.3
TkA02G469810	`PF00069`	Pkinase	89	179	5.4e-19	69.3
TkA02G469810	`PF07714`	PK_Tyr_Ser-Thr	91	178	8.2e-12	45.7
TkA02G469810	`PF03612`	EIIBC-GUT_N	112	172	0.47	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKW4`	Arabidopsis thaliana	sp\|Q9FKW4\|CDPKS_ARATH Calcium-dependent protein kinase 28	58.200%	Swiss-Prot	High
`Q7XJR9`	Arabidopsis thaliana	sp\|Q7XJR9\|CDPKG_ARATH Calcium-dependent protein kinase 16	79.600%	Swiss-Prot	Medium
`Q1PE17`	Arabidopsis thaliana	sp\|Q1PE17\|CDPKI_ARATH Calcium-dependent protein kinase 18	77.200%	Swiss-Prot	Medium
`Q0D715`	Oryza sativa subsp. japonica	sp\|Q0D715\|CDPKI_ORYSJ Calcium-dependent protein kinase 18	71.400%	Swiss-Prot	Medium
`Q6Z2M9`	Oryza sativa subsp. japonica	sp\|Q6Z2M9\|CDPK4_ORYSJ Calcium-dependent protein kinase 4	73.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card