LXL04_013822 | RubberDandelionOmics

Gene overview

LXL04_013822

Reference: OH-1004 Chr: Chr03 Coordinates: 36460531-36464460 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1659 bp · LXL04_013822|LXL04_013822|OH1004|cDNA

ATGGGTGCCTGTTTGTCAACCACTAAGATCAGTGGCTCCAACAGCACCACCGCCGATCGCCGCCGGACAGAAACTGCCACCGGCAAGCATAATGTCAAATCCGATACACCCACAGAGATCCACAGGAATCAACACCAAAAACACAGGACCCAACAGCAGAACAATAACAAAAACAAGAGGAAAGAAAGGTCGTCTTCAAAAAATGGAGTGATTCCATGTGGGAAAACAACCGATTTTGGGTACCTTAAGGATTTTGATAG...

CDS

Download CDS FASTA

1659 bp · LXL04_013822|LXL04_013822|OH1004|CDS

ATGGGTGCCTGTTTGTCAACCACTAAGATCAGTGGCTCCAACAGCACCACCGCCGATCGCCGCCGGACAGAAACTGCCACCGGCAAGCATAATGTCAAATCCGATACACCCACAGAGATCCACAGGAATCAACACCAAAAACACAGGACCCAACAGCAGAACAATAACAAAAACAAGAGGAAAGAAAGGTCGTCTTCAAAAAATGGAGTGATTCCATGTGGGAAAACAACCGATTTTGGGTACCTTAAGGATTTTGATAG...

Protein

Download Protein FASTA

552 aa · LXL04_013822|LXL04_013822|OH1004|PROTEIN

MGACLSTTKISGSNSTTADRRRTETATGKHNVKSDTPTEIHRNQHQKHRTQQQNNNKNKRKERSSSKNGVIPCGKTTDFGYLKDFDSTYSIGKLLGHGQFGYTYVAIDKANGDRVAVKKIDKNKMILPIAVEDVKREVKILQALSGHENVVQFHNAYEDSSYVYIVMELCEGGELLDRILGKKDSRYSEKDAAIVVRQMLKVAAECHLHGLVHRDMKPENFLFKSKKDDSHLKATDFGLSDFIRPGRKFTDIVGSAYYVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013822`
TK1151 ID	TkA02G469810
OH-1004 ID	LXL04_013822
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 32.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013822

Location Chr03:36460531-36464460 (+)

Description Similar to CPK28: Calcium-dependent protein kinase 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66210`	May play a role in signal transduction pathways that involve calcium as a second messenger (Probable).	Function of calcium-dependent protein kinase CPK28 of Arabidopsis thaliana in plant stem elongation and vascular development.2013 · DOI: 10.1111/tpj.12090 The calcium-dependent protein kinase CPK28 buffers plant immunity and regulates BIK1 turnover.2014 · DOI: 10.1016/j.chom.2014.10.007 Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486
`At2g17890`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At4g36070`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0409900`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	A rice calcium-dependent protein kinase is expressed in cortical root cells during the presymbiotic phase of the arbuscular mycorrhizal symbiosis.2011 · DOI: 10.1186/1471-2229-11-90 Rice small C2-domain proteins are phosphorylated by calcium-dependent protein kinase.2013 · DOI: 10.1007/s10059-013-2185-0 Direct phosphorylation and activation of a mitogen-activated protein kinase by a calcium-dependent protein kinase in rice.2014 · DOI: 10.1105/tpc.114.126441
`Os02g0126400`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013822 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051592 response to calcium ion Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17890

ath:AT4G36070

ath:AT5G66210

dosa:Os02g0126400

dosa:Os07g0409900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.545

Rank 1 · LXL04_013822 · OH-1004

Cytoplasm0.303

Rank 2 · LXL04_013822 · OH-1004

Nucleus0.214

Rank 3 · LXL04_013822 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_013822 · OH-1004

Golgi apparatus0.053

Rank 5 · LXL04_013822 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase89-349 aa

PF07714.24PK_Tyr_Ser-Thr91-342 aa

PF14531.13Kinase-like122-336 aa

PF13499.13EF-hand_7395-457 aa

PF00036.39EF-hand_1396-423 aa

PF13405.13EF-hand_6396-422 aa

PF13202.13EF-hand_5397-419 aa

PF13833.13EF-hand_8409-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013822	`PF00069.32`	Pkinase	89	349	6.1e-71	239.6
LXL04_013822	`PF07714.24`	PK_Tyr_Ser-Thr	91	342	1.8e-29	103.5
LXL04_013822	`PF14531.13`	Kinase-like	122	336	2.5e-06	27.7
LXL04_013822	`PF13499.13`	EF-hand_7	395	457	2.3e-25	89.5
LXL04_013822	`PF00036.39`	EF-hand_1	396	423	3.1e-24	83.4
LXL04_013822	`PF13405.13`	EF-hand_6	396	422	4.2e-19	67.1
LXL04_013822	`PF13202.13`	EF-hand_5	397	419	1.4e-23	81.9
LXL04_013822	`PF13833.13`	EF-hand_8	409	457	4.6e-14	52.6
LXL04_013822	`PF10591.16`	SPARC_Ca_bdg	461	526	8.7e-07	30.0
LXL04_013822	`PF13499.13`	EF-hand_7	477	530	2.3e-25	89.5
LXL04_013822	`PF00036.39`	EF-hand_1	478	497	3.1e-24	83.4
LXL04_013822	`PF13202.13`	EF-hand_5	478	497	1.4e-23	81.9
LXL04_013822	`PF13405.13`	EF-hand_6	478	497	4.2e-19	67.1
LXL04_013822	`PF13833.13`	EF-hand_8	488	530	4.6e-14	52.6
LXL04_013822	`PF13202.13`	EF-hand_5	509	530	1.4e-23	81.9
LXL04_013822	`PF00036.39`	EF-hand_1	510	532	3.1e-24	83.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKW4`	Arabidopsis thaliana	Calcium-dependent protein kinase 28	76.119%	Swiss-Prot	strong database homology
`Q7XJR9`	Arabidopsis thaliana	Calcium-dependent protein kinase 16	73.250%	Swiss-Prot	strong database homology
`Q1PE17`	Arabidopsis thaliana	Calcium-dependent protein kinase 18	70.654%	Swiss-Prot	strong database homology
`Q0D715`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 18	79.296%	Swiss-Prot	strong database homology
`Q6Z2M9`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 4	74.603%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card