TkA02G461030 | RubberDandelionOmics

Gene overview

TkA02G461030

Reference: TK1151 Chr: Chr02 Coordinates: 117471101-117475223 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2333 bp · TkA02G461030|TK1151|cDNA

TGCAAACCAGCAAAGAAGCCATTTTCACACAAAAGGAAGAGAAAATTCTAGTGCCACATAAACCCTAGTAAAACAAAAACAAGAGAAGAGTGTGTCAAATCTTGTTGTCGGTCAGTCTTGTTTGGTTTCTTCTGGTCTACTAGTGATGTTCATATTTTTGGAGCAATCAAGTTTCTATAGAATGGCCAACACCCCTTTAACAGGTTGCTTTTCCCTCTTTGTATTTTTGTGATCTTATTCCTCTATTTTCCAATTTCCAT...

CDS

Download CDS FASTA

1275 bp · TkA02G461030|TK1151|CDS

ATGATACGCGTCGTCTCCCCCAATTCCGAGCTCTGTAAATTCGGATTCTTGGAGACGACACCAAAAGTCGCAGATTCATCTAGACTTGTACGGACGAACAAAATCAAGAATGTTGGTAAGAAGAACAACTGCAATTCCTGCTATTTCGATGCATTTGGTGAATTGGGTTTCCGGGATTTGAAAAACGGGAGAAAATCCGATGTGATTTCGAGGGTGGTGGCTAACCCGACTGGGGAATTGGCCGTTTCATCGGAGCAGAT...

Protein

Download Protein FASTA

424 aa · TkA02G461030|TK1151|PROTEIN

MIRVVSPNSELCKFGFLETTPKVADSSRLVRTNKIKNVGKKNNCNSCYFDAFGELGFRDLKNGRKSDVISRVVANPTGELAVSSEQMVYDVVLKQAALVKEQLRGKKDLEVKPDIVIPGTLGLLSEAYDRCGEVCAEYAKTFYLGTRLMPPEKQKAFWAIYVWCRRTDELVDGPNASHITPKALDRWESRLEDLFNGRPFDMLDAALSDTVSKFPVDIQPFKDMIEGMRLDLVKSRYKTFDELYLYCYYVAGTVGLMSVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G461030`
TK1151 ID	TkA02G461030
OH-1004 ID	LXL04_024809
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.500
Protein coverage (%)	TK1151 96.698 / OH-1004 96.927 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G461030

Location Chr02:117471101-117475223 (+)

Description Similar to PSY1: Bifunctional 15-cis-phytoene synthase, chromoplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17230`	Catalyzes the reaction from prephytoene diphosphate to phytoene.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0729000`	Catalyzes the conversion of geranylgeranyl diphosphate to phytoene.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024809 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009575 chromoplast stroma Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004311 geranylgeranyl diphosphate synthase activity Molecular Function

GO:0046905 15-cis-phytoene synthase activity Molecular Function

GO:0051996 squalene synthase [NAD(P)H] activity Molecular Function

KEGG gene cross-reference

ath:AT5G17230

cann:107868281

sly:543988

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · TkA02G461030 · TK1151

Mitochondrion0.029

Rank 2 · TkA02G461030 · TK1151

Cytoplasm0.022

Rank 3 · TkA02G461030 · TK1151

Peroxisome0.018

Rank 4 · TkA02G461030 · TK1151

Cell membrane0.016

Rank 5 · TkA02G461030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17513DUF544123-62 aa

PF00494SQS_PSY137-394 aa

PF17513DUF5441348-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G461030	`PF17513`	DUF5441	23	62	0.15	12.5
TkA02G461030	`PF00494`	SQS_PSY	137	394	7e-78	262.6
TkA02G461030	`PF17513`	DUF5441	348	368	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P37271`	Arabidopsis thaliana	sp\|P37271\|PSY_ARATH Phytoene synthase 1, chloroplastic	73.300%	Swiss-Prot	High
`Q5Z5B7`	Oryza sativa subsp. japonica	sp\|Q5Z5B7\|PSY1_ORYSJ Phytoene synthase 1, chloroplastic	81.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card