TkA02G454120 | RubberDandelionOmics

Gene overview

TkA02G454120

Reference: TK1151 Chr: Chr02 Coordinates: 115649687-115652042 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · TkA02G454120|TK1151|cDNA

AGATGGGATTTTTTCCATATTTCCAGCTACATAATCCCTTAAATCAAGGATTAACGTTTTCAATTTCGACTTCTGTTTCCCCTTTTCTCGTATTATTCTCTTTGGCTACAAGTAGGAAACCCTTTTTCTCGGCTCATACTGCCGACTCATACCTCGGAAAACTCGTAAAAGATGCTGTGATAACAGTCCCAGCTTATTTCAACGACTCACAACGTCAAGCAACAAAAGATGCCGGCACAATTGCTGGATTAAACGTCATC...

CDS

Download CDS FASTA

336 bp · TkA02G454120|TK1151|CDS

ATGGGATTTTTTCCATATTTCCAGCTACATAATCCCTTAAATCAAGGATTAACGTTTTCAATTTCGACTTCTGTTTCCCCTTTTCTCGTATTATTCTCTTTGGCTACAAGTAGGAAACCCTTTTTCTCGGCTCATACTGCCGACTCATACCTCGGAAAACTCGTAAAAGATGCTGTGATAACAGTCCCAGCTTATTTCAACGACTCACAACGTCAAGCAACAAAAGATGCCGGCACAATTGCTGGATTAAACGTCATCCG...

Protein

Download Protein FASTA

111 aa · TkA02G454120|TK1151|PROTEIN

MGFFPYFQLHNPLNQGLTFSISTSVSPFLVLFSLATSRKPFFSAHTADSYLGKLVKDAVITVPAYFNDSQRQATKDAGTIAGLNVIRIKCCCSTMYLFVRRLLDTKRSRVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G454120`
TK1151 ID	TkA02G454120
OH-1004 ID	LXL04_014038
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 63.964 / OH-1004 25.725 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G454120`
Location	Chr02:115649687-115652042 (-)
Description	Similar to HSP70: Heat shock 70 kDa protein (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014038` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0002181 cytoplasmic translation Biological Process GO:0006457 protein folding Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation Biological Process GO:0006626 protein targeting to mitochondrion Biological Process GO:0009267 cellular response to starvation Biological Process GO:0034605 cellular response to heat Biological Process GO:0035617 stress granule disassembly Biological Process GO:0035719 tRNA import into nucleus Biological Process GO:0042026 protein refolding Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
KEGG gene cross-reference	cbs:COXBURSA331_A1439 cbu:CBU_1290 sce:YAL005C sce:YLL024C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.443

Rank 1 · TkA02G454120 · TK1151

Nucleus0.296

Rank 2 · TkA02G454120 · TK1151

Mitochondrion0.162

Rank 3 · TkA02G454120 · TK1151

Endoplasmic reticulum0.140

Rank 4 · TkA02G454120 · TK1151

Cell membrane0.069

Rank 5 · TkA02G454120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP7045-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G454120	`PF00012`	HSP70	45	88	1.6e-20	73.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card