Gene Card
Gene overview
cDNA / CDS / Protein Sequences
831 bp · LXL04_014038|LXL04_014038|OH1004|cDNA
ATGAATTGTACCGTTGGACTGAGAAATAGCCGTTGGAGCAGCGAAGGAAAGGAGGAACGCCGCGTTCCTCGGCGTTGGAAAAGCGACACGAGGCTACGCCAAGAAGGGAAACGCGCATTCGGGGGCGGTGTGCCAAGCTCCACAACGGCGTTCTGCCCTCCACCTCAGCCGCGTTCTCGTGGCGTTATACCCACACTGGCCCTAATTCGTCATCCGGTTCCATCAGAGCTACCAACGAAGAAGTTGGGGTCGCCTGGCCA...
831 bp · LXL04_014038|LXL04_014038|OH1004|CDS
ATGAATTGTACCGTTGGACTGAGAAATAGCCGTTGGAGCAGCGAAGGAAAGGAGGAACGCCGCGTTCCTCGGCGTTGGAAAAGCGACACGAGGCTACGCCAAGAAGGGAAACGCGCATTCGGGGGCGGTGTGCCAAGCTCCACAACGGCGTTCTGCCCTCCACCTCAGCCGCGTTCTCGTGGCGTTATACCCACACTGGCCCTAATTCGTCATCCGGTTCCATCAGAGCTACCAACGAAGAAGTTGGGGTCGCCTGGCCA...
Protein
Download Protein FASTA276 aa · LXL04_014038|LXL04_014038|OH1004|PROTEIN
MNCTVGLRNSRWSSEGKEERRVPRRWKSDTRLRQEGKRAFGGGVPSSTTAFCPPPQPRSRGVIPTLALIRHPVPSELPTKKLGSPGHFVEIVKRKLGLSRRSEGGVARFQLLHLRHRSIAAEIETLPSSSLSPRFSNPALGARISEITVKPFFSAHTADSYLGKLVKDAVITVPAYFNDSQRQATKDAGTIAGLNVIRIKCCCSTMYLFVRRLLDTKRSRGTIENIKQVHFARGATTRAMEYTGVTTSLEKRNRSAEGQG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014038 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014038 |
|---|---|
| Location | Chr03:41020116-41024225 (+) |
| Description | Similar to HSP70: Heat shock 70 kDa protein (Fragment) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0002181 cytoplasmic translation Biological Process GO:0006457 protein folding Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation Biological Process GO:0006626 protein targeting to mitochondrion Biological Process GO:0009267 cellular response to starvation Biological Process GO:0034605 cellular response to heat Biological Process GO:0035617 stress granule disassembly Biological Process GO:0035719 tRNA import into nucleus Biological Process GO:0042026 protein refolding Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process |
| KEGG gene cross-reference | cbs:COXBURSA331_A1439 cbu:CBU_1290 sce:YAL005C sce:YLL024C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00012.27HSP70156-199 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014038 | PF00012.27 | HSP70 | 156 | 199 | 6e-20 | 71.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.