TkA02G449770 | RubberDandelionOmics

Gene overview

TkA02G449770

Reference: TK1151 Chr: Chr02 Coordinates: 114425157-114428737 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2043 bp · TkA02G449770|TK1151|cDNA

AATAGGCTGAATCACCTCGATAAGAAAAATTAGCAATTAAACCGAAGCCCAGGGTAGCATTTGGTAACTGGTATCGGTTGTTCCAAATTCGATCCAAATCCCAAGCAGGTATTTTGGGGTTTTGAAGAAAACTAGAAGAAAAGCAAGACAAAACCCTTTCTACCTGTCCCTACGCTCGACCATCAGTCAAGCCTCCGCTGTGGACGGTGTCTACTGTCGACGACCTATAACACTTGGAAAGAGTGGGACGCTACTCTATC...

CDS

Download CDS FASTA

1473 bp · TkA02G449770|TK1151|CDS

ATGGCGGAAGAAGCAGTAGTGGGGTATCTGGAAAAGAACAAACAGATAGTAGACTCAGGCGTGTTCGCCGAGGAGCAAGGAATCAGTCATGAAGAGATCGTCAACATCATTAAGAGTCTCAATGCCTTTCGATTCGTCGAAGCTCAGGATATTAAGAAGGAGAGATGGAAACTTACTGAAGAAGGCAAAACTTATGCTGCTAATGGTACTCCAGAATTCCACCTATTCATGGCCTTTCCACCAGAGGGAATTCCAGTAGG...

Protein

Download Protein FASTA

490 aa · TkA02G449770|TK1151|PROTEIN

MAEEAVVGYLEKNKQIVDSGVFAEEQGISHEEIVNIIKSLNAFRFVEAQDIKKERWKLTEEGKTYAANGTPEFHLFMAFPPEGIPVGELKKKLGDLAFKIGCKQAKDKDWIEMGKSISRKVTHVEDDVKAMLVKINNGEALSKEDIAALKKRNIVSPQIWKGFSVTKGPNYAPKRTKPATDLTRENLQRGEWKDMQFKEYNFMAKGLPVEGGYLHPLLKLLQVRRQMQMIFLQMGFEEMPTNNYVESSFWNFDALFQPQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G449770`
TK1151 ID	TkA02G449770
OH-1004 ID	LXL04_034787
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G449770

Location Chr02:114425157-114428737 (-)

Description Similar to At4g39280: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39280`	Phenylalanine--tRNA ligase alpha subunit, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034787 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006432 phenylalanyl-tRNA aminoacylation Biological Process

GO:0051290 protein heterotetramerization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009328 phenylalanine-tRNA ligase complex Cellular Component

GO:0016020 membrane Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0000287 magnesium ion binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0004826 phenylalanine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G39280

hsa:2193

pon:100174218

rno:288917

xla:447019

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · TkA02G449770 · TK1151

Mitochondrion0.199

Rank 2 · TkA02G449770 · TK1151

Nucleus0.170

Rank 3 · TkA02G449770 · TK1151

Plastid0.083

Rank 4 · TkA02G449770 · TK1151

Peroxisome0.065

Rank 5 · TkA02G449770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18552PheRS_DBD13-56 aa

PF18553PheRS_DBD370-124 aa

PF00152tRNA-synt_2118-214 aa

PF01409tRNA-synt_2d200-475 aa

PF17759tRNA_synthFbeta220-247 aa

PF17759tRNA_synthFbeta337-444 aa

PF00152tRNA-synt_2340-366 aa

PF18552PheRS_DBD1347-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G449770	`PF18552`	PheRS_DBD1	3	56	1.4e-07	31.9
TkA02G449770	`PF18553`	PheRS_DBD3	70	124	2.7e-09	37.8
TkA02G449770	`PF00152`	tRNA-synt_2	118	214	0.00014	21.8
TkA02G449770	`PF01409`	tRNA-synt_2d	200	475	8.4e-84	281.6
TkA02G449770	`PF17759`	tRNA_synthFbeta	220	247	0.058	13.6
TkA02G449770	`PF17759`	tRNA_synthFbeta	337	444	0.058	13.6
TkA02G449770	`PF00152`	tRNA-synt_2	340	366	0.00014	21.8
TkA02G449770	`PF18552`	PheRS_DBD1	347	365	1.4e-07	31.9
TkA02G449770	`PF18553`	PheRS_DBD3	419	425	2.7e-09	37.8
TkA02G449770	`PF00152`	tRNA-synt_2	449	469	0.00014	21.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T034`	Arabidopsis thaliana	sp\|Q9T034\|SYFA_ARATH Phenylalanine--tRNA ligase alpha subunit, cytoplasmic	75.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card