TkA02G446540 | RubberDandelionOmics

Gene overview

TkA02G446540

Reference: TK1151 Chr: Chr02 Coordinates: 113499061-113500693 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

748 bp · TkA02G446540|TK1151|cDNA

GGTATTGAACGTGAAATTGCATCTTTACAAATGGAGGAGAGGAAGTTAGTGGCAGAGATTAAAAAGACGGCCAAACTTGGGAATCAGGCTGCCACAAAGATATTAGCTCGACAGCTTGTTCGCCTTAGGCAACAAATAACAAATTTGCAGGGGAGCCGTGCACAAATAAGAGGTGTAGCAACTCATACACAGGCTCTGTATGCCAACACTTCAATATCAACCGGAATGAAAGGTGCAACAAAAGCAATGGTTGCTATGAA...

CDS

Download CDS FASTA

543 bp · TkA02G446540|TK1151|CDS

ATGGAGGAGAGGAAGTTAGTGGCAGAGATTAAAAAGACGGCCAAACTTGGGAATCAGGCTGCCACAAAGATATTAGCTCGACAGCTTGTTCGCCTTAGGCAACAAATAACAAATTTGCAGGGGAGCCGTGCACAAATAAGAGGTGTAGCAACTCATACACAGGCTCTGTATGCCAACACTTCAATATCAACCGGAATGAAAGGTGCAACAAAAGCAATGGTTGCTATGAACAAGGAAATGGCACCTGCAAAACAAGTTAA...

Protein

Download Protein FASTA

180 aa · TkA02G446540|TK1151|PROTEIN

MEERKLVAEIKKTAKLGNQAATKILARQLVRLRQQITNLQGSRAQIRGVATHTQALYANTSISTGMKGATKAMVAMNKEMAPAKQVKVIKEFQKQSSQLDMTIEMMSESVDETLDKDEAEEETEELTNQVLDEIGVGIASQLSSAPKGRIGPKKVENAAPSSVTNDVDDLEKRLASLRRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G446540`
TK1151 ID	TkA02G446540
OH-1004 ID	LXL04_027621
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 83.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G446540

Location Chr02:113499061-113500693 (+)

Description Similar to VPS2.2: Vacuolar protein sorting-associated protein 2 homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44560`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release
`At1g03950`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027621 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0015031 protein transport Biological Process

GO:0031468 nuclear membrane reassembly Biological Process

GO:0032509 endosome transport via multivesicular body sorting pathway Biological Process

GO:0039702 viral budding via host ESCRT complex Biological Process

GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0046761 viral budding from plasma membrane Biological Process

GO:0061952 midbody abscission Biological Process

GO:0070676 intralumenal vesicle formation Biological Process

GO:0071985 multivesicular body sorting pathway Biological Process

GO:0097352 autophagosome maturation Biological Process

KEGG gene cross-reference

ath:AT1G03950

ath:AT2G06530

ath:AT5G44560

ddi:DDB_G0292400

pon:100172566

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.792

Rank 1 · TkA02G446540 · TK1151

Nucleus0.222

Rank 2 · TkA02G446540 · TK1151

Plastid0.073

Rank 3 · TkA02G446540 · TK1151

Mitochondrion0.060

Rank 4 · TkA02G446540 · TK1151

Peroxisome0.051

Rank 5 · TkA02G446540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03357Snf72-149 aa

PF25472DUF79028-45 aa

PF28006HpsJ10-144 aa

PF14348DtrJ-like16-101 aa

PF09278MerR-DNA-bind17-48 aa

PF11652FAM16720-41 aa

PF00700Flagellin_C25-54 aa

PF25472DUF790232-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G446540	`PF03357`	Snf7	2	149	8.1e-32	110.9
TkA02G446540	`PF25472`	DUF7902	8	45	6.9	7.7
TkA02G446540	`PF28006`	HpsJ	10	144	1.2	9.4
TkA02G446540	`PF14348`	DtrJ-like	16	101	0.17	12.1
TkA02G446540	`PF09278`	MerR-DNA-bind	17	48	0.014	16.7
TkA02G446540	`PF11652`	FAM167	20	41	0.12	13.3
TkA02G446540	`PF00700`	Flagellin_C	25	54	0.1	13.7
TkA02G446540	`PF25472`	DUF7902	32	65	6.9	7.7
TkA02G446540	`PF15039`	DUF4530	46	127	0.026	15.4
TkA02G446540	`PF25472`	DUF7902	70	124	6.9	7.7
TkA02G446540	`PF11652`	FAM167	85	136	0.12	13.3
TkA02G446540	`PF00700`	Flagellin_C	91	145	0.1	13.7
TkA02G446540	`PF09278`	MerR-DNA-bind	98	134	0.014	16.7
TkA02G446540	`PF25472`	DUF7902	164	175	6.9	7.7
TkA02G446540	`PF09278`	MerR-DNA-bind	167	180	0.014	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WTY4`	Arabidopsis thaliana	sp\|Q0WTY4\|VPS2B_ARATH Vacuolar protein sorting-associated protein 2 homolog 2	80.100%	Swiss-Prot	High
`Q941D5`	Arabidopsis thaliana	sp\|Q941D5\|VPS2C_ARATH Vacuolar protein sorting-associated protein 2 homolog 3	72.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card