TkA02G444600 | RubberDandelionOmics

Gene overview

TkA02G444600

Reference: TK1151 Chr: Chr02 Coordinates: 112959446-112959922 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA02G444600|TK1151|cDNA

ATGCACCTACTTCTCAGCAGTGCTCTTCAAGATCAATCAAGGCGGGTGGGTCCCACTTGTCATAGCAGCATTCTTTTTTTCGTCATGTACATCTGGCATTACGGGACCGTAAAAAGATATGAATTTGAAATGCACAGTAAAATCTCAATGGCATGGATCCTTGGTCTTGGACCGAGTCTAGGACTCGTGCGGGTCCCAGGAATTGGACTCGTGTACACCGAACTACCAAGTGGGGTCCCACATATATTCTCACATTTCAT...

CDS

Download CDS FASTA

477 bp · TkA02G444600|TK1151|CDS

ATGCACCTACTTCTCAGCAGTGCTCTTCAAGATCAATCAAGGCGGGTGGGTCCCACTTGTCATAGCAGCATTCTTTTTTTCGTCATGTACATCTGGCATTACGGGACCGTAAAAAGATATGAATTTGAAATGCACAGTAAAATCTCAATGGCATGGATCCTTGGTCTTGGACCGAGTCTAGGACTCGTGCGGGTCCCAGGAATTGGACTCGTGTACACCGAACTACCAAGTGGGGTCCCACATATATTCTCACATTTCAT...

Protein

Download Protein FASTA

158 aa · TkA02G444600|TK1151|PROTEIN

MHLLLSSALQDQSRRVGPTCHSSILFFVMYIWHYGTVKRYEFEMHSKISMAWILGLGPSLGLVRVPGIGLVYTELPSGVPHIFSHFITNLPAIHSVLVFVCVKYLPVYTVPEDERFLVKRIGPKNFHMFRCVARYGYKDFTKKTMILKKKYSIICSCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G444600`
TK1151 ID	TkA02G444600
OH-1004 ID	LXL04_014253
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.700
Protein coverage (%)	TK1151 84.177 / OH-1004 15.833 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G444600

Location Chr02:112959446-112959922 (+)

Description Similar to POT11: Potassium transporter 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31120`	Putative potassium transporter.	No verified direct reference in this release
`At2g35060`	Probable potassium transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0563200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os04g0613900`	High-affinity potassium transporter.	No verified direct reference in this release
`Os08g0206400`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014253 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0009555 pollen development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G31120

ath:AT2G35060

dosa:Os04g0613900

dosa:Os09g0563200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.258

Rank 1 · TkA02G444600 · TK1151

Endoplasmic reticulum0.226

Rank 2 · TkA02G444600 · TK1151

Cytoplasm0.219

Rank 3 · TkA02G444600 · TK1151

Lysosome / Vacuole0.188

Rank 4 · TkA02G444600 · TK1151

Nucleus0.151

Rank 5 · TkA02G444600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22776K_trans_C66-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G444600	`PF22776`	K_trans_C	66	149	3.2e-18	66.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA05`	Arabidopsis thaliana	sp\|Q9SA05\|POT10_ARATH Potassium transporter 10	78.200%	Swiss-Prot	High
`O64769`	Arabidopsis thaliana	sp\|O64769\|POT11_ARATH Potassium transporter 11	77.400%	Swiss-Prot	High
`Q653B6`	Oryza sativa subsp. japonica	sp\|Q653B6\|HAK18_ORYSJ Potassium transporter 18	85.700%	Swiss-Prot	High
`Q7XLC6`	Oryza sativa subsp. japonica	sp\|Q7XLC6\|HAK11_ORYSJ Probable potassium transporter 11	76.600%	Swiss-Prot	High
`Q8VXB1`	Oryza sativa subsp. japonica	sp\|Q8VXB1\|HAK12_ORYSJ Putative potassium transporter 12	82.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card