TkA02G430240 | RubberDandelionOmics

Gene overview

TkA02G430240

Reference: TK1151 Chr: Chr02 Coordinates: 109282988-109284656 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

814 bp · TkA02G430240|TK1151|cDNA

CTTGCCTTGTAATTATTACATACTCCGAGTTCCCCTGTCCGGTAGTTCCCGTTGGCGCCCCCATCTAAACTCTAAAGCCCTAAACATAAACCCTCTGAATCAAAAACATACACTCGATACACAGAACTATGGCGATAGGTGGAAGGATATCAAAGATTATTCTGAGCAATCTATTGTCACGATCAACTACAGGTTGTCTATCATCATCATCTTCATTTGGACCTCATTCTATCCTCATCTCACGAAGGGGCATAGCTTCC...

CDS

Download CDS FASTA

432 bp · TkA02G430240|TK1151|CDS

ATGGCGATAGGTGGAAGGATATCAAAGATTATTCTGAGCAATCTATTGTCACGATCAACTACAGGTTGTCTATCATCATCATCTTCATTTGGACCTCATTCTATCCTCATCTCACGAAGGGGCATAGCTTCCAAGCTTTATGTTGCAGGTCTGTCATTTTACACCACAGAAAAGGCATTATCAGATGTGTTTTCTCAATTTGGCCAAGTTGTTGAAGCCACTGTTATGATGGATAAAGTTTCCAGCAGATCAAAAGGCTT...

Protein

Download Protein FASTA

143 aa · TkA02G430240|TK1151|PROTEIN

MAIGGRISKIILSNLLSRSTTGCLSSSSSFGPHSILISRRGIASKLYVAGLSFYTTEKALSDVFSQFGQVVEATVMMDKVSSRSKGFGFITFASELEAEKAINEMDRKTLHGRVIHVELAKPRRAYSSAPIARGPPEPLTDQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G430240`
TK1151 ID	TkA02G430240
OH-1004 ID	LXL04_014396
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G430240

Location Chr02:109282988-109284656 (-)

Description Similar to S-RBP11: Small RNA-binding protein 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06210`	Probable RNA-binding protein that may be involved in salt and oxidative stress tolerance.	The Arabidopsis chloroplast protein S-RBP11 is involved in oxidative and salt stress responses.2014 · DOI: 10.1007/s00299-013-1560-9
`At3g23830`	Possibly has a role in RNA transcription or processing during stress.	Characterization of transgenic Arabidopsis plants overexpressing GR-RBP4 under high salinity, dehydration, or cold stress.2005 · DOI: 10.1093/jxb/eri298
`At4g13850`	Promotes the cis-splicing and editing of several mitochondrial RNAs (including NAD5 transcripts).	No verified direct reference in this release
`At3g20930`	Involved in C-to-U editing of chloroplastic RNA.	An RNA recognition motif-containing protein is required for plastid RNA editing in Arabidopsis and maize.2013 · DOI: 10.1073/pnas.1220162110

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014396 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006858 extracellular transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009845 seed germination Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0050658 RNA transport Biological Process

GO:0050688 regulation of defense response to virus Biological Process

GO:0060567 negative regulation of termination of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G73530

ath:AT3G23830

ath:AT4G13850

ath:AT5G06210

ath:AT5G61030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.837

Rank 1 · TkA02G430240 · TK1151

Plastid0.113

Rank 2 · TkA02G430240 · TK1151

Nucleus0.045

Rank 3 · TkA02G430240 · TK1151

Cytoplasm0.040

Rank 4 · TkA02G430240 · TK1151

Extracellular0.015

Rank 5 · TkA02G430240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16367RRM_744-107 aa

PF00076RRM_146-116 aa

PF13893RRM_548-124 aa

PF28976RRM_ACIN155-107 aa

PF05172RRM_Nup3562-106 aa

PF14605Nup35_RRM_264-101 aa

PF24475RBD_DEAH1176-118 aa

PF11767SET_assoc77-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G430240	`PF16367`	RRM_7	44	107	0.0089	16.7
TkA02G430240	`PF00076`	RRM_1	46	116	1.6e-21	76.6
TkA02G430240	`PF13893`	RRM_5	48	124	0.0043	17.5
TkA02G430240	`PF28976`	RRM_ACIN1	55	107	0.021	15.6
TkA02G430240	`PF05172`	RRM_Nup35	62	106	0.011	16.4
TkA02G430240	`PF14605`	Nup35_RRM_2	64	101	0.057	14.0
TkA02G430240	`PF24475`	RBD_DEAH11	76	118	0.079	13.8
TkA02G430240	`PF11767`	SET_assoc	77	115	0.019	15.3
TkA02G430240	`PF20271`	CATASP	98	140	0.3	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFZ6`	Arabidopsis thaliana	sp\|Q9FFZ6\|RBP11_ARATH Small RNA-binding protein 11, chloroplastic	57.300%	Swiss-Prot	Medium
`Q9LIS2`	Arabidopsis thaliana	sp\|Q9LIS2\|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial	50.900%	Swiss-Prot	High
`Q9SVM8`	Arabidopsis thaliana	sp\|Q9SVM8\|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial	46.500%	Swiss-Prot	Medium
`Q8L440`	Arabidopsis thaliana	sp\|Q8L440\|ORRM1_ARATH Organelle RRM domain-containing protein 1, chloroplastic	46.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card