RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G421570
Reference: TK1151 Chr: Chr02 Coordinates: 107038520-107042311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3418 bp · TkA02G421570|TK1151|cDNA

AGGTTAGGAGGAATGCATGTGATGAAGTAGGTCCACTACAATATTTTATACACCATTTGTCGATTGTCGTTTCATATCTTCACGGAATTCCCCAAAGAAATTTGCCTCAAAACATTCTTTCACACATCTCCATCTTCATAATCACATTCATTCTGTATAACCGTGTTTTTTTCATTTCAGTATGCGCTCCACATAGTTTCTGAAGGGAGAAAGTGTTGATGATGGGTTTTCTCCGACTTTTCGTCTTGGCATTCATCGCA...

CDS

Download CDS FASTA

3018 bp · TkA02G421570|TK1151|CDS

ATGATGGGTTTTCTCCGACTTTTCGTCTTGGCATTCATCGCAACAATTGCTTCTTTCACCATTAATGCCGATGAATCCCCTAAGCTAAACGATGAAGTTTTGGGACTTATAGTCTTCAAATCGTCTCTTACAGACCCATCATCACATTTATCTTCATGGAACCAAGATGATGAAACCCCATGTTCTTGGCAGTTCGTTACCTGCAACCCGGTCACTAGCAGGGTCACCGGACTTTCTCTTGACGGATTGAATCTTTCCGG...

Protein

Download Protein FASTA

1005 aa · TkA02G421570|TK1151|PROTEIN

MMGFLRLFVLAFIATIASFTINADESPKLNDEVLGLIVFKSSLTDPSSHLSSWNQDDETPCSWQFVTCNPVTSRVTGLSLDGLNLSGKIGRGLEKLQNLKVLSLAYNNFTGNINHELSLLPNLEQLNLSKNGFSNRIPGSLMSSGSIKFLDLSENSLSGPVSEEFFINCLSLRSLSLSGNNLEGPIPSSLSNCTTLNHLDLSNNRFSGNPDFKSGIWSMIRVRTLDLSHNSFSGSIPNGVFALHDLKELLLQGNDFTGAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G421570
TK1151 IDTkA02G421570
OH-1004 IDLXL04_014493
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)96.800
Protein coverage (%)TK1151 99.900 / OH-1004 64.535
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G421570
LocationChr02:107038520-107042311 (+)
DescriptionSimilar to At3g28040: Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g28040 Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040. No verified direct reference in this release
At3g56370 Probable LRR receptor-like serine/threonine-protein kinase IRK. No verified direct reference in this release
At5g01890 Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development. No verified direct reference in this release
At1g12460 Probable LRR receptor-like serine/threonine-protein kinase At1g12460. No verified direct reference in this release
At2g35620 Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).
Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014493 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0035556 intracellular signal transduction Biological Process
GO:0048364 root development Biological Process
GO:0051302 regulation of cell division Biological Process
GO:0080092 regulation of pollen tube growth Biological Process
GO:0090511 periclinal cell division Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function
GO:0005509 calcium ion binding Molecular Function
KEGG gene cross-reference
ath:AT2G31500
ath:AT3G28040
ath:AT3G56370
dosa:Os07g0568600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862
Rank 1 · TkA02G421570 · TK1151
Endoplasmic reticulum0.089
Rank 2 · TkA02G421570 · TK1151
Cytoplasm0.063
Rank 3 · TkA02G421570 · TK1151
Nucleus0.050
Rank 4 · TkA02G421570 · TK1151
Lysosome / Vacuole0.027
Rank 5 · TkA02G421570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_229-69 aa
PF29594LRR_SKP273-135 aa
PF00560LRR_177-96 aa
PF12799LRR_479-113 aa
PF23598LRR_1490-138 aa
PF23952LRR_EndoS92-155 aa
PF13855LRR_893-132 aa
PF14580LRR_993-151 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G421570PF08263LRRNT_229695.9e-1452.8
TkA02G421570PF29594LRR_SKP2731352e-1247.7
TkA02G421570PF00560LRR_177968.9e-54168.5
TkA02G421570PF12799LRR_4791136.4e-30103.2
TkA02G421570PF23598LRR_14901383e-2899.3
TkA02G421570PF23952LRR_EndoS921555.28.0
TkA02G421570PF13855LRR_8931324e-47158.5
TkA02G421570PF14580LRR_9931511.19.5
TkA02G421570PF13516LRR_6961111.5e-1041.0
TkA02G421570PF24758LRR_At5g56370961551.3e-0628.9
TkA02G421570PF23211LRR_LRWD1961331.4e-0525.6
TkA02G421570PF12799LRR_4971316.4e-30103.2
TkA02G421570PF00560LRR_1981188.9e-54168.5
TkA02G421570PF24141LRR_ComC1101891.6e-0525.5
TkA02G421570PF24048LRR_NXF1-51201825.4e-0523.6
TkA02G421570PF12799LRR_41211586.4e-30103.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LRT1Arabidopsis thalianasp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g2804070.700%Swiss-ProtHigh
Q9LY03Arabidopsis thalianasp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK44.900%Swiss-ProtLow
Q9LZV7Arabidopsis thalianasp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC242.000%Swiss-ProtLow
C0LGE4Arabidopsis thalianasp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g1246045.300%Swiss-ProtLow
C0LGL9Arabidopsis thalianasp|C0LGL9|FEI2_ARATH LRR receptor-like serine/threonine-protein kinase FEI 242.300%Swiss-ProtLow

JBrowse

View in Genome Browser