TkA02G417840 | RubberDandelionOmics

Gene overview

TkA02G417840

Reference: TK1151 Chr: Chr02 Coordinates: 106223532-106225221 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · TkA02G417840|TK1151|cDNA

TCCCCTTCTATGTCAATGGGCGGCGGAACAGAAAAATCATTCGCGTCAACGGCGGCCGGAGATATGACTACTCCGAAAGAAAGAGAAGAAGATGTAAGCTTGGCTGAGTTAAAGAAGAAAATGGCCGATTTTGCAAAGGAAAGAGATTGGGATCAGTTTCACAGTCCCCGAAATCTTCTCCTCGCACTGGTAGGAGAAGTGGGAGAGTTATCTGAGATATTTCAATGGAAAGGAGAGGTACCAAAGGGACTTCCTGATTG...

CDS

Download CDS FASTA

507 bp · TkA02G417840|TK1151|CDS

ATGTCAATGGGCGGCGGAACAGAAAAATCATTCGCGTCAACGGCGGCCGGAGATATGACTACTCCGAAAGAAAGAGAAGAAGATGTAAGCTTGGCTGAGTTAAAGAAGAAAATGGCCGATTTTGCAAAGGAAAGAGATTGGGATCAGTTTCACAGTCCCCGAAATCTTCTCCTCGCACTGGTAGGAGAAGTGGGAGAGTTATCTGAGATATTTCAATGGAAAGGAGAGGTACCAAAGGGACTTCCTGATTGGAAAAAAGA...

Protein

Download Protein FASTA

168 aa · TkA02G417840|TK1151|PROTEIN

MSMGGGTEKSFASTAAGDMTTPKEREEDVSLAELKKKMADFAKERDWDQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLPDWKKEEKEHLGEELSDVLLYLVRLSDICGIDLGKAALRKLQVNANKYPVNLSKGSSKKHNQIINNLPPPSTTNDNGNGSGSVDDGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G417840`
TK1151 ID	TkA02G417840
OH-1004 ID	LXL04_014506
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G417840`
Location	Chr02:106223532-106225221 (-)
Description	Similar to Dctpp1: dCTP pyrophosphatase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014506` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006253 dCTP catabolic process Biological Process GO:0009143 nucleoside triphosphate catabolic process Biological Process GO:0042262 DNA protection Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0000287 magnesium ion binding Molecular Function GO:0016462 pyrophosphatase activity Molecular Function GO:0032556 pyrimidine deoxyribonucleotide binding Molecular Function GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference	bta:614103 hsa:79077 mmu:66422 rno:192252 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.581

Rank 1 · TkA02G417840 · TK1151

Nucleus0.427

Rank 2 · TkA02G417840 · TK1151

Plastid0.124

Rank 3 · TkA02G417840 · TK1151

Mitochondrion0.057

Rank 4 · TkA02G417840 · TK1151

Peroxisome0.054

Rank 5 · TkA02G417840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17928TetR_C_2211-61 aa

PF12643MazG-like32-40 aa

PF03819MazG52-120 aa

PF12643MazG-like63-142 aa

PF17928TetR_C_2277-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G417840	`PF17928`	TetR_C_22	11	61	0.23	12.5
TkA02G417840	`PF12643`	MazG-like	32	40	1.6e-08	35.4
TkA02G417840	`PF03819`	MazG	52	120	2.1e-06	28.6
TkA02G417840	`PF12643`	MazG-like	63	142	1.6e-08	35.4
TkA02G417840	`PF17928`	TetR_C_22	77	104	0.23	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card