TkA02G414400 | RubberDandelionOmics

Gene overview

TkA02G414400

Reference: TK1151 Chr: Chr02 Coordinates: 105372463-105375418 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1762 bp · TkA02G414400|TK1151|cDNA

ACTTTTTTCTCACTCTTTTCTACACATTCATGCAACAAGACGTACAATTCGTTGCTCTGTTATTCCTTCCGTTGGTCTTCTGTTTCTGTATACTATTTTCGAGAAAGAAACACGAAGCTTTACTTTAAAAAGTTCCGACTTTTCAAAACCCTTTACCATAAACATGTGATCAATCACCTTCCATATGAATCGATTGCGAAAAAGATCCTTTTACAAGATACCCATTTTGCCAAGACAGCCAAAAAGGTTAAAATTTTATG...

CDS

Download CDS FASTA

981 bp · TkA02G414400|TK1151|CDS

ATGGGGGGAATGTCGTCTGATAATATACATGGGCTTGTATTAGCTATATCTTCAAGTGTATTTATTGGATCTAGCTTTATTATTAAGAAAAAAGGTCTCATGAAAGCTGGTGCTACCGGAATTCGAGCAGGTGAAGGAGGCTACTCATACTTGAAGGAACCATGGTGGTGGGCCGGCATGGTGAGCATGATTATAGGGGAGGTAGCAAACTTTGCTGCGTATGCATACGCGCCAGCAATTCTTGTAACCCCATTAGGAGC...

Protein

Download Protein FASTA

326 aa · TkA02G414400|TK1151|PROTEIN

MGGMSSDNIHGLVLAISSSVFIGSSFIIKKKGLMKAGATGIRAGEGGYSYLKEPWWWAGMVSMIIGEVANFAAYAYAPAILVTPLGALSMIISAVLAHYFLDERLHIFGVVGCALCLVGSTVIVLHAPQEIQVSSVKQVWFFATEPRFLVYVFLVLLLVGILIYRYVPLYGRTHLVIYVGICSLMGSLTVMCVKAVGIAMKLSFSGSNQFIYFQTWVFTLLLLGLCLTQLNYLNKALDTFNTAVISPVYYVMFTSLTILA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G414400`
TK1151 ID	TkA02G414400
OH-1004 ID	LXL04_004064
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.100
Protein coverage (%)	TK1151 91.104 / OH-1004 93.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G414400

Location Chr02:105372463-105375418 (-)

Description Similar to At4g13800: Probable magnesium transporter NIPA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23870`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At4g13800`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At1g71900`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At1g34470`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At4g09640`	Acts as a Mg(2+) transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004064 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015693 magnesium ion transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015095 magnesium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34470

ath:AT1G71900

ath:AT3G23870

ath:AT4G09640

ath:AT4G13800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.413

Rank 1 · TkA02G414400 · TK1151

Cytoplasm0.242

Rank 2 · TkA02G414400 · TK1151

Cell membrane0.227

Rank 3 · TkA02G414400 · TK1151

Golgi apparatus0.204

Rank 4 · TkA02G414400 · TK1151

Endoplasmic reticulum0.104

Rank 5 · TkA02G414400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05653Mg_trans_NIPA7-299 aa

PF00892EamA11-35 aa

PF00892EamA58-124 aa

PF00892EamA138-163 aa

PF10968DUF2770148-161 aa

PF27291AF_1457161-194 aa

PF10968DUF2770172-185 aa

PF00892EamA184-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G414400	`PF05653`	Mg_trans_NIPA	7	299	4.2e-132	440.5
TkA02G414400	`PF00892`	EamA	11	35	1.5e-07	32.5
TkA02G414400	`PF00892`	EamA	58	124	1.5e-07	32.5
TkA02G414400	`PF00892`	EamA	138	163	1.5e-07	32.5
TkA02G414400	`PF10968`	DUF2770	148	161	1.9	9.2
TkA02G414400	`PF27291`	AF_1457	161	194	2.8	8.9
TkA02G414400	`PF10968`	DUF2770	172	185	1.9	9.2
TkA02G414400	`PF00892`	EamA	184	295	1.5e-07	32.5
TkA02G414400	`PF27291`	AF_1457	190	234	2.8	8.9
TkA02G414400	`PF10968`	DUF2770	248	253	1.9	9.2
TkA02G414400	`PF27291`	AF_1457	251	290	2.8	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIR9`	Arabidopsis thaliana	sp\|Q9LIR9\|NIPA1_ARATH Probable magnesium transporter NIPA1	72.000%	Swiss-Prot	High
`B3LFA3`	Arabidopsis thaliana	sp\|B3LFA3\|NIPA2_ARATH Probable magnesium transporter NIPA2	68.700%	Swiss-Prot	High
`Q94AH3`	Arabidopsis thaliana	sp\|Q94AH3\|NIPA4_ARATH Probable magnesium transporter NIPA4	67.400%	Swiss-Prot	High
`Q9LNK7`	Arabidopsis thaliana	sp\|Q9LNK7\|NIPA3_ARATH Probable magnesium transporter NIPA3	67.300%	Swiss-Prot	High
`F4JKQ7`	Arabidopsis thaliana	sp\|F4JKQ7\|NIPA5_ARATH Probable magnesium transporter NIPA5	69.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card