LXL04_004064 | RubberDandelionOmics

Gene overview

LXL04_004064

Reference: OH-1004 Chr: Chr01 Coordinates: 123850416-123852379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

951 bp · LXL04_004064|LXL04_004064|OH1004|cDNA

ATGGAGGAAATATCATCTGATAATGTGTACGGACTAATTCTAGCTATGGCATCAAGTATATTCATTGGGTCTAGCTTTATTGTCAAGAAAAAAGGTCTCATGAAGGCCGGTGCTTCAGGAACCAGAGCAGGTTCAGGAGGCCACTCATACTTGAAGCAACCACTATGGTGGGTTGGTATGGTGAGCATGGTTTTAGGAGAAATAGCGAATTTTGCAGCATATGCATTTGCTCCTGCCATTCTTGTCACCCCCTTGGGAGC...

CDS

Download CDS FASTA

951 bp · LXL04_004064|LXL04_004064|OH1004|CDS

ATGGAGGAAATATCATCTGATAATGTGTACGGACTAATTCTAGCTATGGCATCAAGTATATTCATTGGGTCTAGCTTTATTGTCAAGAAAAAAGGTCTCATGAAGGCCGGTGCTTCAGGAACCAGAGCAGGTTCAGGAGGCCACTCATACTTGAAGCAACCACTATGGTGGGTTGGTATGGTGAGCATGGTTTTAGGAGAAATAGCGAATTTTGCAGCATATGCATTTGCTCCTGCCATTCTTGTCACCCCCTTGGGAGC...

Protein

Download Protein FASTA

316 aa · LXL04_004064|LXL04_004064|OH1004|PROTEIN

MEEISSDNVYGLILAMASSIFIGSSFIVKKKGLMKAGASGTRAGSGGHSYLKQPLWWVGMVSMVLGEIANFAAYAFAPAILVTPLGALSIIVSAVLAHYFLDERMHIFGVVGCVLCLVGSTAIVLHAPHETLVSSVKQVWYFATEPGFLVYASIVVVVVGVLIYHYEPRYGQTHLIVYVGICSLMGSLTVMCVKAVGIAIKLSFSGHNQFIYFQTWFFTLLLLGFCLMQLNYLNKALDTFNTNVVSPVYYVMFTTLTILA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004064`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004064

Location Chr01:123850416-123852379 (+)

Description Similar to At4g13800: Probable magnesium transporter NIPA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13800`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At1g34470`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At1g71900`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At3g23870`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At4g09640`	Acts as a Mg(2+) transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004064 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015693 magnesium ion transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015095 magnesium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34470

ath:AT1G71900

ath:AT3G23870

ath:AT4G09640

ath:AT4G13800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.440

Rank 1 · LXL04_004064 · OH-1004

Cytoplasm0.221

Rank 2 · LXL04_004064 · OH-1004

Golgi apparatus0.208

Rank 3 · LXL04_004064 · OH-1004

Cell membrane0.199

Rank 4 · LXL04_004064 · OH-1004

Endoplasmic reticulum0.111

Rank 5 · LXL04_004064 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05653.21Mg_trans_NIPA7-299 aa

PF00892.27EamA58-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004064	`PF05653.21`	Mg_trans_NIPA	7	299	7.8e-136	452.7
LXL04_004064	`PF00892.27`	EamA	58	124	3e-06	28.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3LFA3`	Arabidopsis thaliana	Probable magnesium transporter NIPA2	72.258%	Swiss-Prot	strong database homology
`Q9LNK7`	Arabidopsis thaliana	Probable magnesium transporter NIPA3	70.946%	Swiss-Prot	strong database homology
`Q94AH3`	Arabidopsis thaliana	Probable magnesium transporter NIPA4	69.257%	Swiss-Prot	strong database homology
`Q9LIR9`	Arabidopsis thaliana	Probable magnesium transporter NIPA1	72.848%	Swiss-Prot	strong database homology
`F4JKQ7`	Arabidopsis thaliana	Probable magnesium transporter NIPA5	70.707%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card