TkA02G413330 | RubberDandelionOmics

Gene overview

TkA02G413330

Reference: TK1151 Chr: Chr02 Coordinates: 105121651-105122046 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA02G413330|TK1151|cDNA

ATGCTATATATCAATGGAAGCCTACAAGATCATCTCCAAGACCCCAATAAAAGACGTGACCTATCGTGGACACAACGCCTGAAGATTTGCATAGGGGCAGCAAAAGGACTCAAGCACCTACACTCAGGTTCCAGAGAGAACCGAACAGTAATACACAAAAACATCAAGGCGTCAAACATATTGTTGGATGCTAATTTAGAAGCCAAAATTTGTGATTTTGGTTTTAGACCTCCGCCGGTAATTAGTATCCATACAACTTA...

CDS

Download CDS FASTA

396 bp · TkA02G413330|TK1151|CDS

ATGCTATATATCAATGGAAGCCTACAAGATCATCTCCAAGACCCCAATAAAAGACGTGACCTATCGTGGACACAACGCCTGAAGATTTGCATAGGGGCAGCAAAAGGACTCAAGCACCTACACTCAGGTTCCAGAGAGAACCGAACAGTAATACACAAAAACATCAAGGCGTCAAACATATTGTTGGATGCTAATTTAGAAGCCAAAATTTGTGATTTTGGTTTTAGACCTCCGCCGGTAATTAGTATCCATACAACTTA...

Protein

Download Protein FASTA

131 aa · TkA02G413330|TK1151|PROTEIN

MLYINGSLQDHLQDPNKRRDLSWTQRLKICIGAAKGLKHLHSGSRENRTVIHKNIKASNILLDANLEAKICDFGFRPPPVISIHTTYVGNGFYMDPNYMETGILTEESDIYSFGVLLFETLSGMLVRTRIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G413330`
TK1151 ID	TkA02G413330
OH-1004 ID	LXL04_014807
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.800
Protein coverage (%)	TK1151 95.420 / OH-1004 35.501 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G413330

Location Chr02:105121651-105122046 (-)

Description Similar to PBL23: Probable serine/threonine-protein kinase PBL23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At1g67720`	Probable LRR receptor-like serine/threonine-protein kinase At1g67720.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g07180`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ERL1 and ER.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014807 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0043680 filiform apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G20530

ath:AT3G46290

ath:AT5G02290

ath:AT5G59700

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.583

Rank 1 · TkA02G413330 · TK1151

Nucleus0.282

Rank 2 · TkA02G413330 · TK1151

Cell membrane0.247

Rank 3 · TkA02G413330 · TK1151

Mitochondrion0.045

Rank 4 · TkA02G413330 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA02G413330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr5-122 aa

PF00069Pkinase5-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G413330	`PF07714`	PK_Tyr_Ser-Thr	5	122	9.6e-20	71.7
TkA02G413330	`PF00069`	Pkinase	5	124	2.5e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80623`	Arabidopsis thaliana	sp\|O80623\|Y2393_ARATH Probable receptor-like protein kinase At2g39360	47.500%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	47.000%	Swiss-Prot	Medium
`C0LGI2`	Arabidopsis thaliana	sp\|C0LGI2\|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720	49.200%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	45.500%	Swiss-Prot	Medium
`Q6XAT2`	Arabidopsis thaliana	sp\|Q6XAT2\|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2	49.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card