TkA02G394900 | RubberDandelionOmics

Gene overview

TkA02G394900

Reference: TK1151 Chr: Chr02 Coordinates: 100322594-100325356 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2185 bp · TkA02G394900|TK1151|cDNA

GTGAATTTTACATGTATTGTGGGTCAGAGAGCATTTAAATTATTTGCAAAGTTTTGGCATAAAACCCCAATTTCATTACTCTTCGAGAGAAAGGGGTGGCAGCAGTTACTCTTGGATGCGCAGATGCAGACTCCAAAAACAAGTACGAAGACGTCATCCGAAGGTTCTCGGAAGATCTCTCCTCGATCGATTTCTTCAGACACGGGCCAAAAAAGCTCAGGTCGAACCGCACGCCAACTGAAGACGACTGGACTCGAACC...

CDS

Download CDS FASTA

1743 bp · TkA02G394900|TK1151|CDS

GTGAATTTTACATGTATTGTGGGTCAGAGAGCATTTAAATTATTTGCAAAGTTTTGGCATAAAACCCCAATTTCATTACTCTTCGAGAGAAAGGGGTGGCAGCAGTTACTCTTGGATGCGCAGATGCAGACTCCAAAAACAAGTACGAAGACGTCATCCGAAGGTTCTCGGAAGATCTCTCCTCGATCGATTTCTTCAGACACGGGCCAAAAAAGCTCAGGTCGAACCGCACGCCAACTGAAGACGACTGGACTCGAACC...

Protein

Download Protein FASTA

580 aa · TkA02G394900|TK1151|PROTEIN

VNFTCIVGQRAFKLFAKFWHKTPISLLFERKGWQQLLLDAQMQTPKTSTKTSSEGSRKISPRSISSDTGQKSSGRTARQLKTTGLEPNSSSLNQPTIRTPKRTTPVIVARRSPQSPISEKKRPVRVAELETQISQLKDDLKNVKDELVSSESRKDQAKQDAEEARKQLLAMSSRLDESQKLLDRSYSDKTHGIQDVDEVWSWISKLESAKKLHSADLDSLANVLDEINQLQIKLDGKVNSKDIQSESAIAVLHSLKATMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G394900`
TK1151 ID	TkA02G394900
OH-1004 ID	LXL04_014814
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 100.000 / OH-1004 94.224 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G394900

Location Chr02:100322594-100325356 (-)

Description Similar to ICR3: Interactor of constitutive active ROPs 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60210`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At2g37080`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release
`At1g78430`	Acts as a scaffold, mediating interaction of ROPs with different proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014814 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G17140

ath:AT1G78430

ath:AT2G37080

ath:AT3G53350

ath:AT5G60210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.532

Rank 1 · TkA02G394900 · TK1151

Nucleus0.291

Rank 2 · TkA02G394900 · TK1151

Cell membrane0.232

Rank 3 · TkA02G394900 · TK1151

Plastid0.064

Rank 4 · TkA02G394900 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA02G394900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26095CC_Bre133-176 aa

PF30842LEKR1119-183 aa

PF23649FKBP15124-232 aa

PF12795MscS_porin125-185 aa

PF28019HmpF125-519 aa

PF05335DUF745126-195 aa

PF28422CCDC89126-197 aa

PF20904ExsD_M127-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G394900	`PF26095`	CC_Bre1	33	176	0.023	15.7
TkA02G394900	`PF30842`	LEKR1	119	183	0.0055	17.7
TkA02G394900	`PF23649`	FKBP15	124	232	3.6	7.9
TkA02G394900	`PF12795`	MscS_porin	125	185	0.12	12.7
TkA02G394900	`PF28019`	HmpF	125	519	1.2	8.2
TkA02G394900	`PF05335`	DUF745	126	195	0.025	15.0
TkA02G394900	`PF28422`	CCDC89	126	197	1.9	8.5
TkA02G394900	`PF20904`	ExsD_M	127	170	0.35	11.9
TkA02G394900	`PF27682`	ICR5_C	128	171	9e-18	65.7
TkA02G394900	`PF24161`	CCDC39	156	341	0.85	8.1
TkA02G394900	`PF26095`	CC_Bre1	170	227	0.023	15.7
TkA02G394900	`PF28422`	CCDC89	202	328	1.9	8.5
TkA02G394900	`PF23649`	FKBP15	213	328	3.6	7.9
TkA02G394900	`PF30842`	LEKR1	216	267	0.0055	17.7
TkA02G394900	`PF30126`	YHR127W_C	217	265	0.25	12.1
TkA02G394900	`PF27682`	ICR5_C	235	264	9e-18	65.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSS5`	Arabidopsis thaliana	sp\|Q9LSS5\|ICR3_ARATH Interactor of constitutive active ROPs 3	34.800%	Swiss-Prot	Medium
`Q9ZQC5`	Arabidopsis thaliana	sp\|Q9ZQC5\|ICR2_ARATH Interactor of constitutive active ROPs 2, chloroplastic	24.800%	Swiss-Prot	Low
`Q9M9F9`	Arabidopsis thaliana	sp\|Q9M9F9\|ICR4_ARATH Interactor of constitutive active ROPs 4	32.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card