RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G392430
Reference: TK1151 Chr: Chr02 Coordinates: 99734774-99742050 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4784 bp · TkA02G392430|TK1151|cDNA

AGCCTCTCCTTGAAAATTACATATTTTAACCCAAAACGCAATCCCTATTATTTTGACCTTTCGTGTTTATTTATATATAATTAAATATATTTATCTCCATTGGTTCCATTATCAGTATAATATAATCCAAAGTTCTCCATTTATAAACAATTGGGTTCTTTTATTTATTCGACGCTAATTTCCCTTTTTACAAGTTATATCGACCGCTTACCTTTTGTATATATATTGTTGGGAAACTATTTCTTTATTTCCTACTTTAC...

CDS

Download CDS FASTA

2151 bp · TkA02G392430|TK1151|CDS

ATGGAGTGCTTGCAGCCCAACATAGACCCAAGGATTAATGCATCGACAATTGGGGAAGCCCTTCTTAAATCAAGAAGTTTTTACACCGAAGATTACTGGTTCTATATATCTATTGGAGTACTCATAGGATTCTCAATCCTCTTCAACTTATTATTTATCGTCGCACTAACTTTCTTAAATCCTCTTGGTGATGCTAAAACTGTTATCAGAGATGAAAGTGAAGTCAAGAAGTCAAACAGTCAACTCTATGAAAGTAACGA...

Protein

Download Protein FASTA

716 aa · TkA02G392430|TK1151|PROTEIN

MECLQPNIDPRINASTIGEALLKSRSFYTEDYWFYISIGVLIGFSILFNLLFIVALTFLNPLGDAKTVIRDESEVKKSNSQLYESNEMTEKRKNGSTVDRIERRGMVLPFRPLSLAFNHVNYSIDMPAEMKGKGVENGRLELLKNVSGAFRPGILTALVGVSGAGKTTLMDVLAGRKTGGCIEGSIFISGYAKNQTTFARVSGYCEQNDIHSPNVTVYESLLYSAWLRLSSDVNSRTRKMFVDELMELMELNPIRDAIVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G392430
TK1151 IDTkA02G392430
OH-1004 IDLXL04_014844
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.900
Protein coverage (%)TK1151 99.302 / OH-1004 50.713
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G392430
LocationChr02:99734774-99742050 (-)
DescriptionSimilar to ABCG39: ABC transporter G family member 39
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g66950 May be a general defense protein. No verified direct reference in this release
At2g36380 May be a general defense protein. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0587600 May be a general defense protein. No verified direct reference in this release
Os07g0522500 ABC transporter modulating cadmium (Cd) import, thus controlling Cd²⁺ accumulation to prevent phytotoxicity.
Rice ABCG43 is Cd inducible and confers Cd tolerance on yeast.2011 · DOI: 10.1271/bbb.110193
Cadmium accumulation regulated by a rice heavy-metal importer is harmful for host plant and leaf bacteria.2023 · DOI: 10.1016/j.jare.2022.05.010
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000302 response to reactive oxygen species Biological Process
GO:0009914 hormone transport Biological Process
GO:0042908 xenobiotic transport Biological Process
GO:2000032 regulation of secondary shoot formation Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0005524 ATP binding Molecular Function
GO:0016887 ATP hydrolysis activity Molecular Function
GO:0140359 ABC-type transporter activity Molecular Function
KEGG gene cross-reference
ath:AT1G66950
ath:AT2G36380
dosa:Os11g0587600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.415
Rank 1 · TkA02G392430 · TK1151
Lysosome / Vacuole0.230
Rank 2 · TkA02G392430 · TK1151
Endoplasmic reticulum0.201
Rank 3 · TkA02G392430 · TK1151
Cytoplasm0.133
Rank 4 · TkA02G392430 · TK1151
Golgi apparatus0.124
Rank 5 · TkA02G392430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08370PDR_assoc11-69 aa
PF06422PDR_CDR21-61 aa
PF12698ABC2_membrane_336-53 aa
PF01061ABC2_membrane37-55 aa
PF00005ABC_tran143-295 aa
PF02463SMC_N145-331 aa
PF03193RsgA_GTPase154-176 aa
PF13304AAA_21155-174 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G392430PF08370PDR_assoc11696.7e-2484.1
TkA02G392430PF06422PDR_CDR21610.02115.4
TkA02G392430PF12698ABC2_membrane_336530.1711.7
TkA02G392430PF01061ABC2_membrane37558.6e-56189.5
TkA02G392430PF00005ABC_tran1432952.4e-2177.5
TkA02G392430PF02463SMC_N1453310.01315.6
TkA02G392430PF03193RsgA_GTPase1541760.09413.3
TkA02G392430PF13304AAA_211551742.4e-0731.8
TkA02G392430PF13555AAA_291551720.02715.0
TkA02G392430PF13604AAA_301551750.09213.2
TkA02G392430PF13671AAA_331551780.2312.5
TkA02G392430PF13238AAA_181582110.1113.8
TkA02G392430PF13304AAA_212743282.4e-0731.8
TkA02G392430PF19055ABC2_membrane_73243849.5e-0935.3
TkA02G392430PF01061ABC2_membrane4416538.6e-56189.5
TkA02G392430PF19055ABC2_membrane_74485789.5e-0935.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7PC84Arabidopsis thalianasp|Q7PC84|AB39G_ARATH ABC transporter G family member 3966.900%Swiss-ProtHigh
Q7PC87Arabidopsis thalianasp|Q7PC87|AB34G_ARATH ABC transporter G family member 3466.000%Swiss-ProtHigh
Q8GU84Oryza sativa subsp. japonicasp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 4859.600%Swiss-ProtHigh
Q8GU86Oryza sativa subsp. japonicasp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 4359.700%Swiss-ProtHigh

JBrowse

View in Genome Browser